Gene Gene information from NCBI Gene database.
Entrez ID 6878
Gene name TATA-box binding protein associated factor 6
Gene symbol TAF6
Synonyms (NCBI Gene)
ALYUSMGC:8964TAF(II)70TAF(II)80TAF2ETAFII-70TAFII-80TAFII70TAFII80TAFII85
Chromosome 7
Chromosome location 7q22.1
Summary Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs374993554 A>G,T Likely-pathogenic, pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs727503778 G>A Pathogenic Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs1131691405 C>T Likely-pathogenic Splice donor variant
rs1554387469 C>T Likely-pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
37
miRTarBase ID miRNA Experiments Reference
MIRT028133 hsa-miR-93-5p Sequencing 20371350
MIRT040207 hsa-miR-615-3p CLASH 23622248
MIRT550110 hsa-miR-3609 PAR-CLIP 21572407
MIRT550109 hsa-miR-548ah-5p PAR-CLIP 21572407
MIRT550108 hsa-miR-8060 PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000124 Component SAGA complex IEA
GO:0003677 Function DNA binding IDA 15601843
GO:0003677 Function DNA binding IEA
GO:0003713 Function Transcription coactivator activity IBA
GO:0005515 Function Protein binding IPI 7667268, 9045704, 15328371, 15601843, 15899866, 21994455, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602955 11540 ENSG00000106290
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49848
Protein name Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80)
Protein function The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT
PDB 5FUR , 6F3T , 6MZC , 6MZD , 6MZL , 6MZM , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGF , 7EGG , 7EGH , 7EGI , 7EGJ , 7ENA , 7ENC , 8GXQ , 8GXS , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02969 TAF 11 76 TATA box binding protein associated factor (TAF) Domain
PF07571 TAF6_C 308 397 TAF6 C-terminal HEAT repeat domain Family
Sequence
MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHM
GKRQKLTTSDIDYALK
LKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINT
PLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKG
KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKY
VHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFT
KSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQ
QEGERIRSVLDGPVLSNIDRIGA
DHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIV
MSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGP
GSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGT
PKANGSQPNSGSPQPAP
Sequence length 677
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Basal transcription factors   RNA Polymerase II Pre-transcription Events
Regulation of TP53 Activity through Phosphorylation
RNA polymerase II transcribes snRNA genes
RNA Polymerase II Promoter Escape
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
RNA Polymerase II Transcription Initiation
RNA Polymerase II Transcription Initiation And Promoter Clearance
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
36
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Alazami-Yuan syndrome Pathogenic rs727503778 RCV000241539
Cornelia de Lange syndrome 1 Pathogenic rs727503778 RCV000157054
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormal facial shape Conflicting classifications of pathogenicity rs374993554 RCV000162155
Cervical cancer Benign rs4134901 RCV005908720
Gastric cancer Benign rs4134901 RCV005908722
Global developmental delay Conflicting classifications of pathogenicity rs374993554 RCV000162155
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Congenital Abnormalities Associate 36849876
De Lange Syndrome Associate 25574841
Developmental Disabilities Associate 36849876
Genetic Diseases Inborn Associate 25574841
Neoplasms Associate 18628956