Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6876
Gene name Gene Name - the full gene name approved by the HGNC.	Transgelin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TAGLN
Synonyms (NCBI Gene) Gene synonyms aliases	SM22, SM22-alpha, SMCC, TAGLN1, TGLN, WS3-10
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The enc

Show/Hide all(157)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021406	hsa-miR-9-5p	Microarray	17612493
MIRT022018	hsa-miR-128-3p	Microarray	17612493
MIRT023899	hsa-miR-1-3p	Other	20458751
MIRT025891	hsa-miR-7-5p	Microarray	17612493
MIRT030313	hsa-miR-26b-5p	Microarray	19088304
MIRT496609	hsa-miR-3714	PAR-CLIP	22291592
MIRT496608	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496607	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496606	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496605	hsa-miR-1321	PAR-CLIP	22291592
MIRT496604	hsa-miR-4739	PAR-CLIP	22291592
MIRT496603	hsa-miR-4756-5p	PAR-CLIP	22291592
MIRT496602	hsa-miR-4419a	PAR-CLIP	22291592
MIRT496601	hsa-miR-4510	PAR-CLIP	22291592
MIRT496600	hsa-miR-6127	PAR-CLIP	22291592
MIRT496599	hsa-miR-6129	PAR-CLIP	22291592
MIRT496598	hsa-miR-6130	PAR-CLIP	22291592
MIRT496597	hsa-miR-6133	PAR-CLIP	22291592
MIRT496596	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT496595	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT496594	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT496593	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT496592	hsa-miR-149-3p	PAR-CLIP	22291592
MIRT496591	hsa-miR-4728-5p	PAR-CLIP	22291592
MIRT496590	hsa-miR-6785-5p	PAR-CLIP	22291592
MIRT496589	hsa-miR-6883-5p	PAR-CLIP	22291592
MIRT496588	hsa-miR-486-3p	PAR-CLIP	22291592
MIRT496587	hsa-miR-6762-5p	PAR-CLIP	22291592
MIRT496586	hsa-miR-6845-5p	PAR-CLIP	22291592
MIRT496609	hsa-miR-3714	PAR-CLIP	22291592
MIRT496608	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496607	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496606	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496605	hsa-miR-1321	PAR-CLIP	22291592
MIRT496604	hsa-miR-4739	PAR-CLIP	22291592
MIRT496603	hsa-miR-4756-5p	PAR-CLIP	22291592
MIRT496602	hsa-miR-4419a	PAR-CLIP	22291592
MIRT496601	hsa-miR-4510	PAR-CLIP	22291592
MIRT496600	hsa-miR-6127	PAR-CLIP	22291592
MIRT496599	hsa-miR-6129	PAR-CLIP	22291592
MIRT496598	hsa-miR-6130	PAR-CLIP	22291592
MIRT496597	hsa-miR-6133	PAR-CLIP	22291592
MIRT496596	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT496595	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT496594	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT496593	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT496592	hsa-miR-149-3p	PAR-CLIP	22291592
MIRT496591	hsa-miR-4728-5p	PAR-CLIP	22291592
MIRT496590	hsa-miR-6785-5p	PAR-CLIP	22291592
MIRT496589	hsa-miR-6883-5p	PAR-CLIP	22291592
MIRT496588	hsa-miR-486-3p	PAR-CLIP	22291592
MIRT496587	hsa-miR-6762-5p	PAR-CLIP	22291592
MIRT496586	hsa-miR-6845-5p	PAR-CLIP	22291592
MIRT1410153	hsa-miR-1275	CLIP-seq
MIRT1410154	hsa-miR-28-5p	CLIP-seq
MIRT1410155	hsa-miR-3139	CLIP-seq
MIRT1410156	hsa-miR-4487	CLIP-seq
MIRT1410157	hsa-miR-4525	CLIP-seq
MIRT1410158	hsa-miR-4665-5p	CLIP-seq
MIRT1410159	hsa-miR-4723-5p	CLIP-seq
MIRT1410160	hsa-miR-4731-5p	CLIP-seq
MIRT1410161	hsa-miR-625	CLIP-seq
MIRT1410162	hsa-miR-637	CLIP-seq
MIRT1410163	hsa-miR-708	CLIP-seq
MIRT1554407	hsa-miR-1184	CLIP-seq
MIRT1554408	hsa-miR-1262	CLIP-seq
MIRT1554409	hsa-miR-1827	CLIP-seq
MIRT1554410	hsa-miR-1915	CLIP-seq
MIRT1554411	hsa-miR-22	CLIP-seq
MIRT1554412	hsa-miR-2467-5p	CLIP-seq
MIRT1554413	hsa-miR-2682	CLIP-seq
MIRT1410154	hsa-miR-28-5p	CLIP-seq
MIRT1554414	hsa-miR-3136-3p	CLIP-seq
MIRT1410155	hsa-miR-3139	CLIP-seq
MIRT1554415	hsa-miR-3150b-3p	CLIP-seq
MIRT1554416	hsa-miR-3160-5p	CLIP-seq
MIRT1554417	hsa-miR-3173-3p	CLIP-seq
MIRT1554418	hsa-miR-3184	CLIP-seq
MIRT1554419	hsa-miR-3188	CLIP-seq
MIRT1554420	hsa-miR-328	CLIP-seq
MIRT1554421	hsa-miR-34a	CLIP-seq
MIRT1554422	hsa-miR-34c-5p	CLIP-seq
MIRT1554423	hsa-miR-361-3p	CLIP-seq
MIRT1554424	hsa-miR-3653	CLIP-seq
MIRT1554425	hsa-miR-3975	CLIP-seq
MIRT1554426	hsa-miR-4259	CLIP-seq
MIRT1554427	hsa-miR-4270	CLIP-seq
MIRT1554428	hsa-miR-4316	CLIP-seq
MIRT1554429	hsa-miR-4441	CLIP-seq
MIRT1554430	hsa-miR-4455	CLIP-seq
MIRT1554431	hsa-miR-4488	CLIP-seq
MIRT1554432	hsa-miR-449a	CLIP-seq
MIRT1554433	hsa-miR-449b	CLIP-seq
MIRT1554434	hsa-miR-449c	CLIP-seq
MIRT1554435	hsa-miR-4505	CLIP-seq
MIRT1554436	hsa-miR-4640-3p	CLIP-seq
MIRT1554437	hsa-miR-4649-3p	CLIP-seq
MIRT1554438	hsa-miR-4656	CLIP-seq
MIRT1554439	hsa-miR-4697-5p	CLIP-seq
MIRT1554440	hsa-miR-4701-3p	CLIP-seq
MIRT1554441	hsa-miR-4710	CLIP-seq
MIRT1554442	hsa-miR-4726-3p	CLIP-seq
MIRT1410160	hsa-miR-4731-5p	CLIP-seq
MIRT1554443	hsa-miR-4784	CLIP-seq
MIRT1554444	hsa-miR-485-5p	CLIP-seq
MIRT1554445	hsa-miR-555	CLIP-seq
MIRT1554446	hsa-miR-558	CLIP-seq
MIRT1554447	hsa-miR-604	CLIP-seq
MIRT1410162	hsa-miR-637	CLIP-seq
MIRT1554448	hsa-miR-647	CLIP-seq
MIRT1410163	hsa-miR-708	CLIP-seq
MIRT1554449	hsa-miR-764	CLIP-seq
MIRT1554450	hsa-miR-765	CLIP-seq
MIRT1554451	hsa-miR-935	CLIP-seq
MIRT1554452	hsa-miR-940	CLIP-seq
MIRT2433768	hsa-miR-1587	CLIP-seq
MIRT2433769	hsa-miR-4492	CLIP-seq
MIRT2433770	hsa-miR-4498	CLIP-seq
MIRT1554435	hsa-miR-4505	CLIP-seq
MIRT1554438	hsa-miR-4656	CLIP-seq
MIRT2433771	hsa-miR-762	CLIP-seq
MIRT2433768	hsa-miR-1587	CLIP-seq
MIRT2433769	hsa-miR-4492	CLIP-seq
MIRT2433770	hsa-miR-4498	CLIP-seq
MIRT1554435	hsa-miR-4505	CLIP-seq
MIRT1554438	hsa-miR-4656	CLIP-seq
MIRT2433771	hsa-miR-762	CLIP-seq
MIRT1554407	hsa-miR-1184	CLIP-seq
MIRT1554408	hsa-miR-1262	CLIP-seq
MIRT2638336	hsa-miR-140-3p	CLIP-seq
MIRT1554409	hsa-miR-1827	CLIP-seq
MIRT1410154	hsa-miR-28-5p	CLIP-seq
MIRT1410155	hsa-miR-3139	CLIP-seq
MIRT2638337	hsa-miR-3187-3p	CLIP-seq
MIRT2638338	hsa-miR-330-3p	CLIP-seq
MIRT1554428	hsa-miR-4316	CLIP-seq
MIRT2638339	hsa-miR-4435	CLIP-seq
MIRT2638340	hsa-miR-4446-3p	CLIP-seq
MIRT2638341	hsa-miR-4453	CLIP-seq
MIRT1554430	hsa-miR-4455	CLIP-seq
MIRT1410156	hsa-miR-4487	CLIP-seq
MIRT2638342	hsa-miR-4538	CLIP-seq
MIRT1554438	hsa-miR-4656	CLIP-seq
MIRT2638343	hsa-miR-4685-5p	CLIP-seq
MIRT1554440	hsa-miR-4701-3p	CLIP-seq
MIRT2638344	hsa-miR-4701-5p	CLIP-seq
MIRT1554441	hsa-miR-4710	CLIP-seq
MIRT1410160	hsa-miR-4731-5p	CLIP-seq
MIRT2638345	hsa-miR-493	CLIP-seq
MIRT2638346	hsa-miR-548s	CLIP-seq
MIRT2638347	hsa-miR-588	CLIP-seq
MIRT2638348	hsa-miR-602	CLIP-seq
MIRT1554447	hsa-miR-604	CLIP-seq
MIRT1410162	hsa-miR-637	CLIP-seq
MIRT1554448	hsa-miR-647	CLIP-seq
MIRT1410163	hsa-miR-708	CLIP-seq
MIRT1554452	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
KLF4	Unknown	19486889
MKL1	Activation	14970199
SRF	Activation	14970199

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 22245152, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0007517	Process	Muscle organ development	TAS	9615232
GO:0030855	Process	Epithelial cell differentiation	IDA	21492153

MIM	HGNC	e!Ensembl
600818	11553	ENSG00000149591

Protein

UniProt ID

Q01995

Protein name

Transgelin (22 kDa actin-binding protein) (Protein WS3-10) (Smooth muscle protein 22-alpha) (SM22-alpha)

Protein function

Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00307	CH	24 → 139	Calponin homology (CH) domain	Domain
PF00402	Calponin	175 → 199	Calponin family repeat	Repeat

Sequence

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEG
KDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS

Sequence length

201

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer in childhood cancer survivors treated with more than 10 gray radiotherapy	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (79)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	19848416
Adenoma	Stimulate	37365287
Airway Remodeling	Associate	24828686
Aortic Dissection	Inhibit	27320219, 33910387
Atrial Fibrillation	Associate	34794617, 37967346
Bipolar Disorder	Associate	28117838
Breast Neoplasms	Inhibit	23936147
Breast Neoplasms	Associate	25841305, 28058861, 29059430
Breast Neoplasms	Stimulate	37834385
Bronchopulmonary Dysplasia	Associate	24828686, 30001393
Carcinogenesis	Associate	26344167
Carcinoma Hepatocellular	Associate	34001947
Carcinoma Non Small Cell Lung	Stimulate	22245152
Cardiovascular Diseases	Associate	34902367
Chronic Periodontitis	Associate	30922293
Colonic Polyps	Associate	37365287
Colorectal Neoplasms	Inhibit	19329940, 32353950
Colorectal Neoplasms	Associate	19724680, 23138394, 23372686, 27270312, 33096021
COVID 19	Stimulate	39676863
Death	Stimulate	39676863
Diabetes Gestational	Stimulate	29949406
Diabetes Gestational	Associate	35768543
Diabetic Nephropathies	Associate	36949528
Diaphyseal medullary stenosis with malignant fibrous histiocytoma	Associate	12401825
Endometrial Neoplasms	Associate	20236630
Endometrial Stromal Tumors	Associate	25991737
Erectile Dysfunction	Associate	38111702
Esophageal Neoplasms	Associate	26344167
Esophageal Squamous Cell Carcinoma	Associate	15986332, 21517111, 26344167
Esophageal Squamous Cell Carcinoma	Stimulate	29020885
Esophageal Squamous Cell Carcinoma	Inhibit	37203411
Fibrosis	Associate	33245228, 36725885
Frailty	Stimulate	37697678
Gallbladder Neoplasms	Associate	24657443
Gallstones	Stimulate	25671835
Hamman Rich Syndrome	Associate	35527237
Heart Defects Congenital	Associate	30338626
Hereditary Breast and Ovarian Cancer Syndrome	Associate	29059430
Hypoxia	Associate	15026807
Hypoxia	Stimulate	22245152
Hypoxia Brain	Associate	22245152
Hypoxia Brain	Inhibit	32098916
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	19177598
Impotence Vasculogenic	Stimulate	29949406
Leiomyosarcoma	Associate	23178314, 25991737
Liver Failure	Associate	19177598
Lung Diseases	Associate	39676863
Lupus Erythematosus Systemic	Inhibit	27402083
Lymphatic Metastasis	Associate	19724680, 26344167
Lymphoma Non Hodgkin	Associate	25991737
Mouth Neoplasms	Associate	39308508
Necrosis	Associate	38013282
Neoplasm Invasiveness	Associate	19848416
Neoplasms	Associate	15986332, 19848416, 22245152, 22257561, 24264315, 28058861, 30918060, 37203411, 38013282
Neoplasms	Inhibit	19329940, 22506042, 23936147, 24657443, 25841305, 26242444, 33771884, 37365287
Neurofibromatosis 1	Stimulate	25109740
Neurofibrosarcoma	Associate	25109740
Osteosarcoma	Associate	12401825, 35665757
Ovarian Neoplasms	Associate	31315664, 36222710
Pelvic Organ Prolapse	Inhibit	26612295
Poikiloderma with Neutropenia	Associate	25109740
Prostatic Hyperplasia	Associate	37781794
Prostatic Neoplasms	Associate	24264315, 28510269, 37781794
Prostatic Neoplasms	Inhibit	33771884
Pulmonary Arterial Hypertension	Associate	30338626, 32813135
Pulmonary Disease Chronic Obstructive	Associate	36411774
Rectal Neoplasms	Associate	26861291
Retinal Vein Occlusion	Associate	35808901
Rhabdoid Tumor	Associate	14662021
Sarcoma Endometrial Stromal	Associate	25991737
Severe Acute Respiratory Syndrome	Associate	36834879
Squamous Cell Carcinoma of Head and Neck	Stimulate	26242444
Status Asthmaticus	Stimulate	33245228
Stomach Neoplasms	Associate	12923326, 32410620
Triple Negative Breast Neoplasms	Associate	25841305, 34326372
Ureteral Obstruction	Associate	38013282
Urinary Bladder Neoplasms	Associate	21483740, 21672358, 30633156
Urinary Incontinence Stress	Associate	22136672
Werner Syndrome	Associate	1712899, 8134370

TAGLN (transgelin)