Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6869
Gene name Gene Name - the full gene name approved by the HGNC.	Tachykinin receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TACR1
Synonyms (NCBI Gene) Gene synonyms aliases	NK1R, NKIR, SPR, TAC1R
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, al

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736804	hsa-miR-206	Western blotting, Immunofluorescence	31579977
MIRT1408484	hsa-miR-1245b-3p	CLIP-seq
MIRT1408485	hsa-miR-181a	CLIP-seq
MIRT1408486	hsa-miR-181b	CLIP-seq
MIRT1408487	hsa-miR-181c	CLIP-seq
MIRT1408488	hsa-miR-181d	CLIP-seq
MIRT1408489	hsa-miR-3179	CLIP-seq
MIRT1408490	hsa-miR-3180-5p	CLIP-seq
MIRT1408491	hsa-miR-3664-3p	CLIP-seq
MIRT1408492	hsa-miR-377	CLIP-seq
MIRT1408493	hsa-miR-4262	CLIP-seq
MIRT1408494	hsa-miR-4502	CLIP-seq
MIRT1408495	hsa-miR-4696	CLIP-seq
MIRT1408496	hsa-miR-4762-3p	CLIP-seq
MIRT1408497	hsa-miR-520a-5p	CLIP-seq
MIRT1408498	hsa-miR-520g	CLIP-seq
MIRT1408499	hsa-miR-520h	CLIP-seq
MIRT1408500	hsa-miR-525-5p	CLIP-seq
MIRT1408501	hsa-miR-609	CLIP-seq
MIRT1408502	hsa-miR-873	CLIP-seq
MIRT1408503	hsa-miR-297	CLIP-seq
MIRT1408504	hsa-miR-3187-3p	CLIP-seq
MIRT1408505	hsa-miR-3655	CLIP-seq
MIRT1408506	hsa-miR-3668	CLIP-seq
MIRT1408507	hsa-miR-4252	CLIP-seq
MIRT1408508	hsa-miR-4286	CLIP-seq
MIRT1408509	hsa-miR-4435	CLIP-seq
MIRT1408510	hsa-miR-4646-3p	CLIP-seq
MIRT1408511	hsa-miR-4701-5p	CLIP-seq
MIRT1408512	hsa-miR-548s	CLIP-seq
MIRT1408513	hsa-miR-567	CLIP-seq
MIRT1408514	hsa-miR-588	CLIP-seq
MIRT1408515	hsa-miR-642a	CLIP-seq
MIRT1408516	hsa-miR-892a	CLIP-seq
MIRT1408503	hsa-miR-297	CLIP-seq
MIRT1408504	hsa-miR-3187-3p	CLIP-seq
MIRT1408505	hsa-miR-3655	CLIP-seq
MIRT1408506	hsa-miR-3668	CLIP-seq
MIRT1408507	hsa-miR-4252	CLIP-seq
MIRT1408508	hsa-miR-4286	CLIP-seq
MIRT1408509	hsa-miR-4435	CLIP-seq
MIRT1408510	hsa-miR-4646-3p	CLIP-seq
MIRT1408511	hsa-miR-4701-5p	CLIP-seq
MIRT1408512	hsa-miR-548s	CLIP-seq
MIRT1408513	hsa-miR-567	CLIP-seq
MIRT1408514	hsa-miR-588	CLIP-seq
MIRT1408515	hsa-miR-642a	CLIP-seq
MIRT1408516	hsa-miR-892a	CLIP-seq
MIRT1408505	hsa-miR-3655	CLIP-seq
MIRT1408508	hsa-miR-4286	CLIP-seq
MIRT1408510	hsa-miR-4646-3p	CLIP-seq
MIRT1408515	hsa-miR-642a	CLIP-seq
MIRT1408503	hsa-miR-297	CLIP-seq
MIRT1408504	hsa-miR-3187-3p	CLIP-seq
MIRT1408505	hsa-miR-3655	CLIP-seq
MIRT1408506	hsa-miR-3668	CLIP-seq
MIRT1408507	hsa-miR-4252	CLIP-seq
MIRT1408508	hsa-miR-4286	CLIP-seq
MIRT1408509	hsa-miR-4435	CLIP-seq
MIRT1408510	hsa-miR-4646-3p	CLIP-seq
MIRT1408511	hsa-miR-4701-5p	CLIP-seq
MIRT1408512	hsa-miR-548s	CLIP-seq
MIRT1408513	hsa-miR-567	CLIP-seq
MIRT1408514	hsa-miR-588	CLIP-seq
MIRT1408515	hsa-miR-642a	CLIP-seq
MIRT1408516	hsa-miR-892a	CLIP-seq
MIRT1408503	hsa-miR-297	CLIP-seq
MIRT1408504	hsa-miR-3187-3p	CLIP-seq
MIRT1408505	hsa-miR-3655	CLIP-seq
MIRT1408506	hsa-miR-3668	CLIP-seq
MIRT1408507	hsa-miR-4252	CLIP-seq
MIRT1408509	hsa-miR-4435	CLIP-seq
MIRT1408511	hsa-miR-4701-5p	CLIP-seq
MIRT1408512	hsa-miR-548s	CLIP-seq
MIRT1408513	hsa-miR-567	CLIP-seq
MIRT1408514	hsa-miR-588	CLIP-seq
MIRT1408516	hsa-miR-892a	CLIP-seq

Show/Hide all(72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002118	Process	Aggressive behavior	IEA
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0003051	Process	Angiotensin-mediated drinking behavior	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004995	Function	Tachykinin receptor activity	IEA
GO:0004995	Function	Tachykinin receptor activity	TAS	8985172
GO:0005515	Function	Protein binding	IPI	12716968, 17986524, 23597562, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17986524
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1657150, 10611312
GO:0006954	Process	Inflammatory response	TAS	10854844
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	1657150
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	12716968
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007217	Process	Tachykinin receptor signaling pathway	IDA	17986524
GO:0007217	Process	Tachykinin receptor signaling pathway	IMP	12716968
GO:0007217	Process	Tachykinin receptor signaling pathway	TAS	8985172
GO:0007611	Process	Learning or memory	IEA
GO:0007616	Process	Long-term memory	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008306	Process	Associative learning	IEA
GO:0009582	Process	Detection of abiotic stimulus	TAS	9537323
GO:0009725	Process	Response to hormone	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010193	Process	Response to ozone	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0014910	Process	Regulation of smooth muscle cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016496	Function	Substance P receptor activity	IBA
GO:0016496	Function	Substance P receptor activity	IEA
GO:0016496	Function	Substance P receptor activity	IMP	12716968
GO:0030425	Component	Dendrite	IEA
GO:0032224	Process	Positive regulation of synaptic transmission, cholinergic	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035106	Process	Operant conditioning	IEA
GO:0036126	Component	Sperm flagellum	IDA	17437961
GO:0042713	Process	Sperm ejaculation	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0044297	Component	Cell body	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0046887	Process	Positive regulation of hormone secretion	IEA
GO:0048265	Process	Response to pain	IEA
GO:0048266	Process	Behavioral response to pain	IEA
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0060083	Process	Smooth muscle contraction involved in micturition	IEA
GO:0061827	Component	Sperm head	IDA	17437961
GO:0070472	Process	Regulation of uterine smooth muscle contraction	IEA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0097225	Component	Sperm midpiece	IBA
GO:0097225	Component	Sperm midpiece	IDA	17437961
GO:0097225	Component	Sperm midpiece	IEA
GO:1902093	Process	Positive regulation of flagellated sperm motility	IBA
GO:1902093	Process	Positive regulation of flagellated sperm motility	IEA
GO:1902093	Process	Positive regulation of flagellated sperm motility	IMP	17437961

MIM	HGNC	e!Ensembl
162323	11526	ENSG00000115353

Protein

UniProt ID

P25103

Protein name

Substance-P receptor (SPR) (NK-1 receptor) (NK-1R) (Tachykinin receptor 1)

Protein function

This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substa

PDB

2KS9 , 2KSA , 2KSB , 6E59 , 6HLL , 6HLO , 6HLP , 7P00 , 7P02 , 7RMG , 7RMH , 7RMI , 8U26

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	49 → 305	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS

Sequence length

407

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Tachykinin receptors bind tachykinins G alpha (q) signalling events Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Seborrheic dermatitis	Seborrheic dermatitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (83)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Pain	Associate	23582152
Adenocarcinoma	Associate	37385990
Alcoholism	Associate	19553914, 24817687
Anorexia Nervosa	Associate	28291261
Anxiety	Associate	19545476, 37142998
Anxiety	Inhibit	19553914
Anxiety Disorders	Associate	28291261
Arthritis Psoriatic	Associate	22089831
Arthritis Rheumatoid	Associate	31010320, 9717978
Astrocytoma	Associate	35950469
Attention Deficit Disorder with Hyperactivity	Associate	24817687
Bipolar Disorder	Associate	24817687
Breast Neoplasms	Associate	16291810, 20497542, 24030979, 36797689
Breast Neoplasms	Stimulate	36629320
Cardiomyopathies	Associate	36686487
Cell Transformation Neoplastic	Associate	37385990
Chronic Pain	Associate	23582152
Colitis Associated Neoplasms	Associate	21969570
Colitis Ulcerative	Associate	10940277
Colitis Ulcerative	Stimulate	11073811
Colorectal Neoplasms	Associate	29843798, 34395609
Cough	Associate	16893949
Crohn Disease	Associate	10940277
Crohn Disease	Stimulate	11073811
Cystitis Interstitial	Inhibit	20008142
Depressive Disorder	Associate	30773959, 36686487
Dermatitis Atopic	Associate	9534883
Diabetes Mellitus	Inhibit	22029806
Diabetes Mellitus	Associate	36686487
Digestive System Diseases	Associate	31320834
Endometrial Neoplasms	Associate	27051050
Endometriosis	Associate	19903051
Endometriosis	Stimulate	37405438
Fractures Bone	Associate	36686487
Gastroesophageal Reflux	Associate	29558791
Gastroparesis	Associate	36686487
Glioblastoma	Associate	23166329, 28341744, 30301182, 35434136
Glioma	Associate	23166329, 35434136, 9888463
Graft vs Host Disease	Stimulate	29575692
Heredodegenerative Disorders Nervous System	Associate	33640716
Inflammation	Associate	25684939, 31010320, 33640716, 35950469, 36686487, 9534883
Inflammation	Inhibit	34926694
Inflammatory Bowel Diseases	Associate	10940277, 11073811, 23582152, 25684939
Irritable Bowel Syndrome	Associate	23582152
Kashin Beck Disease	Stimulate	26188273
Leiomyoma	Associate	27456549
Limbal Stem Cell Deficiency	Associate	35334220
Lymphoma Non Hodgkin	Stimulate	21969570
Major Affective Disorder 2	Associate	24817687
Melanoma	Stimulate	36629320
Mental Disorders	Associate	18572194, 28291261
Mouth Diseases	Associate	23553861
Mouth Diseases	Stimulate	33602248
Mucopolysaccharidosis III	Associate	34329663
Multiple Sclerosis	Associate	22039549
Necrosis	Associate	35434136
Neoplasm Metastasis	Associate	34395609, 36177059
Neoplasms	Associate	12746482, 19528498, 19549879, 25684939, 27051050, 29843798, 34395609, 34926694, 35434136, 35950469, 36177059, 36797689, 37385990, 9888463
Neoplasms	Stimulate	21969570, 36629320
Neoplasms Second Primary	Associate	37385990
Neuralgia	Associate	19903051
Neuroblastoma	Associate	34329663
Neurodegenerative Diseases	Associate	34329663
Neuroinflammatory Diseases	Associate	33640716
Osteosarcoma	Associate	36177059
Pain	Associate	19903051, 22069500
Pancreatic Neoplasms	Associate	10816627, 12746482
Peritoneal Neoplasms	Associate	36686487
Personality Disorders	Associate	26114632
Postoperative Nausea and Vomiting	Associate	26012530
Prostatic Neoplasms	Associate	37385990
Pruritus	Associate	37681909
Retinoblastoma	Associate	34187205
Sjogren's Syndrome	Associate	37408182
Sleep Apnea Obstructive	Stimulate	17667845
Squamous Cell Carcinoma of Head and Neck	Associate	19528498
Squamous Cell Carcinoma of Head and Neck	Stimulate	35950469
Tendinopathy	Associate	22069500, 23577779
Thyroid Neoplasms	Associate	32363847
Tooth Erosion	Stimulate	29558791
Urethral Neoplasms	Associate	35950469
Uterine Cervical Neoplasms	Associate	36629320
Visceral Pain	Associate	23582152

TACR1 (tachykinin receptor 1)