Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6867
Gene name Gene Name - the full gene name approved by the HGNC.
Transforming acidic coiled-coil containing protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TACC1
Synonyms (NCBI Gene) Gene synonyms aliases
Ga55
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.22
Summary Summary of gene provided in NCBI Entrez Gene.
This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016082 hsa-miR-374b-5p Sequencing 20371350
MIRT016576 hsa-miR-193b-3p Microarray 20304954
MIRT043739 hsa-miR-342-3p CLASH 23622248
MIRT043593 hsa-miR-148b-3p CLASH 23622248
MIRT652856 hsa-miR-500a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0003713 Function Transcription coactivator activity IMP 20078863
GO:0005515 Function Protein binding IPI 11903063, 12165861, 14603251, 15064709, 17500595, 20078863, 21516116, 23275563, 25416956, 26496610, 26871637, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605301 11522 ENSG00000147526
Protein
UniProt ID O75410
Protein name Transforming acidic coiled-coil-containing protein 1 (Gastric cancer antigen Ga55) (Taxin-1)
Protein function Involved in transcription regulation induced by nuclear receptors, including in T3 thyroid hormone and all-trans retinoic acid pathways (PubMed:20078863). Might promote the nuclear localization of the receptors (PubMed:20078863). Likely involved
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05010 TACC_C 598 798 Transforming acidic coiled-coil-containing protein (TACC), C-terminal Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 3 and isoform 5 are ubiquitous. Isoform 2 is strongly expressed in the brain, weakly detectable in lung and colon, and overexpressed in gastric cancer. Isoform 4 is not detected in normal tissues, but strong expressi
Sequence
MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGN
FETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSEN
EVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSG
KALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRK
KAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSS
DTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISK
SAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPD
NFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALD
ACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVP
VSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSE
SDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTS
MTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYL
ARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERAL
QQKNQEIEELTKICDELI
AKLGKTD
Sequence length 805
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Mountain sickness Chronic mountain sickness N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 21821115
Carcinoma Non Small Cell Lung Associate 36142417
Gastrointestinal Stromal Tumors Associate 27974047
Lymphoma Non Hodgkin Associate 33346834
Melanoma Associate 22817889
Multiple Myeloma Associate 11903063
Neoplasms Associate 11903063, 12087473, 12368191, 27974047, 36446043, 37907864
Neoplasms Neuroepithelial Associate 32859279
Neurocytoma Associate 32859279, 37695397
Stomach Neoplasms Associate 12087473, 24358147