SYT4 (synaptotagmin 4)

Gene

• Entrez ID: 6860
• Gene name: Synaptotagmin 4
• Gene symbol: SYT4
• Synonyms (NCBI Gene): HsT1192
• Chromosome: 18
• Chromosome location: 18q12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020421	hsa-miR-106b-5p	Microarray	17242205
MIRT021609	hsa-miR-142-3p	Microarray	17612493
MIRT038996	hsa-let-7b-3p	CLASH	23622248
MIRT532102	hsa-miR-548m	PAR-CLIP	22012620
MIRT532101	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT532100	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT532099	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT532098	hsa-miR-4272	PAR-CLIP	22012620
MIRT198766	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT532097	hsa-miR-4719	PAR-CLIP	22012620
MIRT532096	hsa-miR-7159-5p	PAR-CLIP	22012620
MIRT532095	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT532094	hsa-miR-421	PAR-CLIP	22012620
MIRT532093	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT439493	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT439493	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT532102	hsa-miR-548m	PAR-CLIP	22012620
MIRT532101	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT532100	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT532099	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT532098	hsa-miR-4272	PAR-CLIP	22012620
MIRT198766	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT532097	hsa-miR-4719	PAR-CLIP	22012620
MIRT532096	hsa-miR-7159-5p	PAR-CLIP	22012620
MIRT532095	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT532094	hsa-miR-421	PAR-CLIP	22012620
MIRT532093	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT1407642	hsa-miR-128	CLIP-seq
MIRT1407643	hsa-miR-2117	CLIP-seq
MIRT1407644	hsa-miR-3157-5p	CLIP-seq
MIRT1407645	hsa-miR-3613-3p	CLIP-seq
MIRT1407646	hsa-miR-3689a-5p	CLIP-seq
MIRT1407647	hsa-miR-3689b	CLIP-seq
MIRT1407648	hsa-miR-3689e	CLIP-seq
MIRT1407649	hsa-miR-3689f	CLIP-seq
MIRT1407650	hsa-miR-371-5p	CLIP-seq
MIRT1407651	hsa-miR-371b-5p	CLIP-seq
MIRT1407652	hsa-miR-3941	CLIP-seq
MIRT1407653	hsa-miR-4255	CLIP-seq
MIRT1407654	hsa-miR-4273	CLIP-seq
MIRT1407655	hsa-miR-4277	CLIP-seq
MIRT1407656	hsa-miR-4424	CLIP-seq
MIRT1407657	hsa-miR-466	CLIP-seq
MIRT1407658	hsa-miR-4672	CLIP-seq
MIRT1407659	hsa-miR-4679	CLIP-seq
MIRT1407660	hsa-miR-4691-3p	CLIP-seq
MIRT1407661	hsa-miR-4699-3p	CLIP-seq
MIRT1407662	hsa-miR-513a-3p	CLIP-seq
MIRT1407663	hsa-miR-513c	CLIP-seq
MIRT1407664	hsa-miR-514b-5p	CLIP-seq
MIRT1407665	hsa-miR-520d-5p	CLIP-seq
MIRT1407666	hsa-miR-524-5p	CLIP-seq
MIRT1407667	hsa-miR-548ac	CLIP-seq
MIRT1407668	hsa-miR-548ae	CLIP-seq
MIRT1407669	hsa-miR-548aj	CLIP-seq
MIRT1407670	hsa-miR-548am	CLIP-seq
MIRT1407671	hsa-miR-548d-3p	CLIP-seq
MIRT1407672	hsa-miR-548x	CLIP-seq
MIRT1407673	hsa-miR-548z	CLIP-seq
MIRT1407674	hsa-miR-590-3p	CLIP-seq
MIRT1407675	hsa-miR-765	CLIP-seq
MIRT2122154	hsa-miR-3140-3p	CLIP-seq
MIRT2122155	hsa-miR-4733-5p	CLIP-seq
MIRT1407642	hsa-miR-128	CLIP-seq
MIRT2344449	hsa-miR-1297	CLIP-seq
MIRT2344450	hsa-miR-1305	CLIP-seq
MIRT2344451	hsa-miR-26a	CLIP-seq
MIRT2344452	hsa-miR-26b	CLIP-seq
MIRT2344453	hsa-miR-27a	CLIP-seq
MIRT2344454	hsa-miR-27b	CLIP-seq
MIRT2344455	hsa-miR-329	CLIP-seq
MIRT2344456	hsa-miR-342-3p	CLIP-seq
MIRT1407645	hsa-miR-3613-3p	CLIP-seq
MIRT2344457	hsa-miR-362-3p	CLIP-seq
MIRT2344458	hsa-miR-377	CLIP-seq
MIRT2344459	hsa-miR-4263	CLIP-seq
MIRT2344460	hsa-miR-4465	CLIP-seq
MIRT2344461	hsa-miR-4775	CLIP-seq
MIRT2344462	hsa-miR-498	CLIP-seq
MIRT1407668	hsa-miR-548ae	CLIP-seq
MIRT1407669	hsa-miR-548aj	CLIP-seq
MIRT1407670	hsa-miR-548am	CLIP-seq
MIRT2344463	hsa-miR-548k	CLIP-seq
MIRT1407672	hsa-miR-548x	CLIP-seq
MIRT2344464	hsa-miR-562	CLIP-seq
MIRT2344465	hsa-miR-576-5p	CLIP-seq
MIRT2433766	hsa-miR-4275	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA	21873635
GO:0001786	Function	Phosphatidylserine binding	IBA	21873635
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006906	Process	Vesicle fusion	IBA	21873635
GO:0007420	Process	Brain development	IEA
GO:0014059	Process	Regulation of dopamine secretion	IBA	21873635
GO:0016192	Process	Vesicle-mediated transport	IBA	21873635
GO:0017075	Function	Syntaxin-1 binding	IEA
GO:0017156	Process	Calcium-ion regulated exocytosis	IBA	21873635
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IBA	21873635
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030173	Component	Integral component of Golgi membrane	NAS	26750488
GO:0030276	Function	Clathrin binding	IBA	21873635
GO:0030285	Component	Integral component of synaptic vesicle membrane	NAS	26750488
GO:0030348	Function	Syntaxin-3 binding	IEA
GO:0030424	Component	Axon	IBA	21873635
GO:0031339	Process	Negative regulation of vesicle fusion	IEA
GO:0032127	Component	Dense core granule membrane	NAS	26750488
GO:0033604	Process	Negative regulation of catecholamine secretion	IGI	20735850
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0044306	Component	Neuron projection terminus	IEA
GO:0045202	Component	Synapse	IBA	21873635
GO:0045955	Process	Negative regulation of calcium ion-dependent exocytosis	NAS	21153436
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	NAS	21153436
GO:0046929	Process	Negative regulation of neurotransmitter secretion	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0061782	Process	Vesicle fusion with vesicle	IEA
GO:0061792	Process	Secretory granule maturation	IEA
GO:0070382	Component	Exocytic vesicle	IBA	21873635
GO:0071277	Process	Cellular response to calcium ion	IBA	21873635
GO:0097449	Component	Astrocyte projection	IEA
GO:0098675	Component	Intrinsic component of neuronal dense core vesicle membrane	IEA
GO:0098992	Component	Neuronal dense core vesicle	ISS
GO:0099519	Process	Dense core granule cytoskeletal transport	ISS
GO:1903861	Process	Positive regulation of dendrite extension	IDA	23999003
GO:1905414	Process	Negative regulation of dense core granule exocytosis	IEA

Other IDs

• MIM: 600103
• HGNC: 11512
• e!Ensembl: ENSG00000132872

Protein

• UniProt ID: Q9H2B2
• Protein name: Synaptotagmin-4 (Synaptotagmin IV) (SytIV)
• Protein function: Synaptotagmin family member which does not bind Ca(2+) (By similarity) (PubMed:23999003). Involved in neuronal dense core vesicles (DCVs) mobility through its interaction with KIF1A. Upon increased neuronal activity, phosphorylation by MAPK8/JNK
• PDB: 1UGK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	168 → 274	C2 domain	Domain
  PF00168	C2	302 → 408	C2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in melanocytes (PubMed:23999003). Expressed in brain. Within brain, expression is highest in hippocampus, with substantial levels also detected in amygdala and thalamus (PubMed:23999003). {ECO:0000269|PubMed:23999003}.
• Sequence:

  MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGV
  DIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLEN
  ATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGL
  PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHF
  TILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQST
  TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
  DIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
  VLCDG

• Sequence length: 425

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	21499247

Unknown
Disease term	Disease name	Evidence	References	Source
Seborrheic dermatitis	Seborrheic dermatitis			GWAS
Diabetes	Diabetes			GWAS
Mental Depression	Mental Depression			GWAS
Metabolic Syndrome	Metabolic Syndrome			GWAS
Myocardial Infarction	Myocardial Infarction			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Diabetes Mellitus Type 2	Associate	26337083
Stomach Neoplasms	Associate	34229539