Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6860
Gene name	Synaptotagmin 4
Gene symbol	SYT4
Synonyms (NCBI Gene)	HsT1192
Chromosome	18
Chromosome location	18q12.3

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020421	hsa-miR-106b-5p	Microarray	17242205
MIRT021609	hsa-miR-142-3p	Microarray	17612493
MIRT038996	hsa-let-7b-3p	CLASH	23622248
MIRT532102	hsa-miR-548m	PAR-CLIP	22012620
MIRT532101	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT532100	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT532099	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT532098	hsa-miR-4272	PAR-CLIP	22012620
MIRT198766	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT532097	hsa-miR-4719	PAR-CLIP	22012620
MIRT532096	hsa-miR-7159-5p	PAR-CLIP	22012620
MIRT532095	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT532094	hsa-miR-421	PAR-CLIP	22012620
MIRT532093	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT439493	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT439493	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT532102	hsa-miR-548m	PAR-CLIP	22012620
MIRT532101	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT532100	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT532099	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT532098	hsa-miR-4272	PAR-CLIP	22012620
MIRT198766	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT532097	hsa-miR-4719	PAR-CLIP	22012620
MIRT532096	hsa-miR-7159-5p	PAR-CLIP	22012620
MIRT532095	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT532094	hsa-miR-421	PAR-CLIP	22012620
MIRT532093	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT1407642	hsa-miR-128	CLIP-seq
MIRT1407643	hsa-miR-2117	CLIP-seq
MIRT1407644	hsa-miR-3157-5p	CLIP-seq
MIRT1407645	hsa-miR-3613-3p	CLIP-seq
MIRT1407646	hsa-miR-3689a-5p	CLIP-seq
MIRT1407647	hsa-miR-3689b	CLIP-seq
MIRT1407648	hsa-miR-3689e	CLIP-seq
MIRT1407649	hsa-miR-3689f	CLIP-seq
MIRT1407650	hsa-miR-371-5p	CLIP-seq
MIRT1407651	hsa-miR-371b-5p	CLIP-seq
MIRT1407652	hsa-miR-3941	CLIP-seq
MIRT1407653	hsa-miR-4255	CLIP-seq
MIRT1407654	hsa-miR-4273	CLIP-seq
MIRT1407655	hsa-miR-4277	CLIP-seq
MIRT1407656	hsa-miR-4424	CLIP-seq
MIRT1407657	hsa-miR-466	CLIP-seq
MIRT1407658	hsa-miR-4672	CLIP-seq
MIRT1407659	hsa-miR-4679	CLIP-seq
MIRT1407660	hsa-miR-4691-3p	CLIP-seq
MIRT1407661	hsa-miR-4699-3p	CLIP-seq
MIRT1407662	hsa-miR-513a-3p	CLIP-seq
MIRT1407663	hsa-miR-513c	CLIP-seq
MIRT1407664	hsa-miR-514b-5p	CLIP-seq
MIRT1407665	hsa-miR-520d-5p	CLIP-seq
MIRT1407666	hsa-miR-524-5p	CLIP-seq
MIRT1407667	hsa-miR-548ac	CLIP-seq
MIRT1407668	hsa-miR-548ae	CLIP-seq
MIRT1407669	hsa-miR-548aj	CLIP-seq
MIRT1407670	hsa-miR-548am	CLIP-seq
MIRT1407671	hsa-miR-548d-3p	CLIP-seq
MIRT1407672	hsa-miR-548x	CLIP-seq
MIRT1407673	hsa-miR-548z	CLIP-seq
MIRT1407674	hsa-miR-590-3p	CLIP-seq
MIRT1407675	hsa-miR-765	CLIP-seq
MIRT2122154	hsa-miR-3140-3p	CLIP-seq
MIRT2122155	hsa-miR-4733-5p	CLIP-seq
MIRT1407642	hsa-miR-128	CLIP-seq
MIRT2344449	hsa-miR-1297	CLIP-seq
MIRT2344450	hsa-miR-1305	CLIP-seq
MIRT2344451	hsa-miR-26a	CLIP-seq
MIRT2344452	hsa-miR-26b	CLIP-seq
MIRT2344453	hsa-miR-27a	CLIP-seq
MIRT2344454	hsa-miR-27b	CLIP-seq
MIRT2344455	hsa-miR-329	CLIP-seq
MIRT2344456	hsa-miR-342-3p	CLIP-seq
MIRT1407645	hsa-miR-3613-3p	CLIP-seq
MIRT2344457	hsa-miR-362-3p	CLIP-seq
MIRT2344458	hsa-miR-377	CLIP-seq
MIRT2344459	hsa-miR-4263	CLIP-seq
MIRT2344460	hsa-miR-4465	CLIP-seq
MIRT2344461	hsa-miR-4775	CLIP-seq
MIRT2344462	hsa-miR-498	CLIP-seq
MIRT1407668	hsa-miR-548ae	CLIP-seq
MIRT1407669	hsa-miR-548aj	CLIP-seq
MIRT1407670	hsa-miR-548am	CLIP-seq
MIRT2344463	hsa-miR-548k	CLIP-seq
MIRT1407672	hsa-miR-548x	CLIP-seq
MIRT2344464	hsa-miR-562	CLIP-seq
MIRT2344465	hsa-miR-576-5p	CLIP-seq
MIRT2433766	hsa-miR-4275	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	NAS	26750488
GO:0000149	Function	SNARE binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006906	Process	Vesicle fusion	IBA
GO:0007269	Process	Neurotransmitter secretion	IEA
GO:0007613	Process	Memory	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IEA
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030672	Component	Synaptic vesicle membrane	NAS	26750488
GO:0031045	Component	Dense core granule	IEA
GO:0031338	Process	Regulation of vesicle fusion	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031982	Component	Vesicle	IEA
GO:0032127	Component	Dense core granule membrane	NAS	26750488
GO:0033604	Process	Negative regulation of catecholamine secretion	IGI	20735850
GO:0036477	Component	Somatodendritic compartment	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0045202	Component	Synapse	IBA
GO:0045955	Process	Negative regulation of calcium ion-dependent exocytosis	NAS	21153436
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	NAS	21153436
GO:0046872	Function	Metal ion binding	IEA
GO:0048174	Process	Negative regulation of short-term neuronal synaptic plasticity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050709	Process	Negative regulation of protein secretion	IEA
GO:0061891	Function	Calcium ion sensor activity	IBA
GO:0070382	Component	Exocytic vesicle	IBA
GO:0097449	Component	Astrocyte projection	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	ISS
GO:0099012	Component	Neuronal dense core vesicle membrane	IEA
GO:0099012	Component	Neuronal dense core vesicle membrane	IEA
GO:0099502	Process	Calcium-dependent activation of synaptic vesicle fusion	IBA
GO:0099519	Process	Dense core granule cytoskeletal transport	IEA
GO:0099519	Process	Dense core granule cytoskeletal transport	ISS
GO:0150035	Process	Regulation of trans-synaptic signaling by BDNF, modulating synaptic transmission	IEA
GO:0150044	Process	Regulation of postsynaptic dense core vesicle exocytosis	IEA
GO:1903531	Process	Negative regulation of secretion by cell	IEA
GO:1903861	Process	Positive regulation of dendrite extension	IDA	23999003
GO:1905415	Process	Positive regulation of dense core granule exocytosis	IEA
GO:1905433	Process	Negative regulation of retrograde trans-synaptic signaling by neuropeptide	IEA
GO:1990742	Component	Microvesicle	IEA
GO:2000301	Process	Negative regulation of synaptic vesicle exocytosis	IEA

MIM	HGNC	e!Ensembl
600103	11512	ENSG00000132872

Q9H2B2

Protein name

Synaptotagmin-4 (Synaptotagmin IV) (SytIV)

Protein function

Synaptotagmin family member which does not bind Ca(2+) (By similarity) (PubMed:23999003). Involved in neuronal dense core vesicles (DCVs) mobility through its interaction with KIF1A. Upon increased neuronal activity, phosphorylation by MAPK8/JNK

PDB

1UGK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	168 → 274	C2 domain	Domain
PF00168	C2	302 → 408	C2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in melanocytes (PubMed:23999003). Expressed in brain. Within brain, expression is highest in hippocampus, with substantial levels also detected in amygdala and thalamus (PubMed:23999003). {ECO:0000269|PubMed:23999003}.

Sequence

MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGV
DIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLEN
ATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGL
PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHF
TILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
VLCDG

Sequence length

425

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-OPERATIVE STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER RESPIRATORY TRACT DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Diabetes Mellitus Type 2	Associate	26337083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34229539	★★★★★ ★☆☆☆☆ Found in Text Mining only

SYT4 (synaptotagmin 4)