Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6850
Gene name	Spleen associated tyrosine kinase
Gene symbol	SYK
Synonyms (NCBI Gene)	IMD82p72-Syk
Chromosome	9
Chromosome location	9q22.2
Summary	This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular r

357

Show/Hide all (357)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043443	hsa-miR-331-3p	CLASH	23622248
MIRT040474	hsa-miR-615-3p	CLASH	23622248
MIRT038521	hsa-miR-99b-3p	CLASH	23622248
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT717204	hsa-miR-5190	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679140	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT679139	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT679138	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT608318	hsa-miR-1976	HITS-CLIP	23824327
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679137	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT679136	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT679135	hsa-miR-1468-5p	HITS-CLIP	23824327
MIRT679134	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT679133	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT608310	hsa-miR-4279	HITS-CLIP	23824327
MIRT679132	hsa-miR-498	HITS-CLIP	23824327
MIRT679131	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT679130	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	24906430
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	24906430
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	24906430
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	24906430
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	24906430
MIRT608318	hsa-miR-1976	HITS-CLIP	24906430
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	24906430
MIRT608315	hsa-miR-3199	HITS-CLIP	24906430
MIRT608313	hsa-miR-8052	HITS-CLIP	24906430
MIRT608312	hsa-miR-365a-5p	HITS-CLIP	24906430
MIRT608311	hsa-miR-365b-5p	HITS-CLIP	24906430
MIRT608310	hsa-miR-4279	HITS-CLIP	24906430
MIRT608323	hsa-miR-4643	HITS-CLIP	24906430
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	24906430
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	24906430
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	24906430
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	24906430
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	24906430
MIRT608318	hsa-miR-1976	HITS-CLIP	24906430
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	24906430
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	24906430
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	24906430
MIRT608315	hsa-miR-3199	HITS-CLIP	24906430
MIRT608313	hsa-miR-8052	HITS-CLIP	24906430
MIRT608312	hsa-miR-365a-5p	HITS-CLIP	24906430
MIRT608311	hsa-miR-365b-5p	HITS-CLIP	24906430
MIRT608310	hsa-miR-4279	HITS-CLIP	24906430
MIRT732575	hsa-miR-1269a	MicroarrayqRT-PCR	34258170
MIRT733940	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCR	33402173
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT717204	hsa-miR-5190	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679140	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT679139	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT679138	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT608318	hsa-miR-1976	HITS-CLIP	23824327
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679137	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT679136	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT679135	hsa-miR-1468-5p	HITS-CLIP	23824327
MIRT679134	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT679133	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT608310	hsa-miR-4279	HITS-CLIP	23824327
MIRT679132	hsa-miR-498	HITS-CLIP	23824327
MIRT679131	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT679130	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT1405255	hsa-miR-1225-5p	CLIP-seq
MIRT1405256	hsa-miR-1238	CLIP-seq
MIRT1405257	hsa-miR-1299	CLIP-seq
MIRT1405258	hsa-miR-136	CLIP-seq
MIRT1405259	hsa-miR-219-5p	CLIP-seq
MIRT1405260	hsa-miR-23a	CLIP-seq
MIRT1405261	hsa-miR-23b	CLIP-seq
MIRT1405262	hsa-miR-23c	CLIP-seq
MIRT1405263	hsa-miR-2861	CLIP-seq
MIRT1405264	hsa-miR-3125	CLIP-seq
MIRT1405265	hsa-miR-324-5p	CLIP-seq
MIRT1405266	hsa-miR-370	CLIP-seq
MIRT1405267	hsa-miR-3916	CLIP-seq
MIRT1405268	hsa-miR-4312	CLIP-seq
MIRT1405269	hsa-miR-4445	CLIP-seq
MIRT1405270	hsa-miR-4453	CLIP-seq
MIRT1405271	hsa-miR-4512	CLIP-seq
MIRT1405272	hsa-miR-4538	CLIP-seq
MIRT1405273	hsa-miR-4646-3p	CLIP-seq
MIRT1405274	hsa-miR-4687-3p	CLIP-seq
MIRT1405275	hsa-miR-4764-5p	CLIP-seq
MIRT1405276	hsa-miR-4779	CLIP-seq
MIRT1405277	hsa-miR-4782-3p	CLIP-seq
MIRT1405278	hsa-miR-4782-5p	CLIP-seq
MIRT1405279	hsa-miR-508-3p	CLIP-seq
MIRT1405280	hsa-miR-5096	CLIP-seq
MIRT1405281	hsa-miR-511	CLIP-seq
MIRT1405282	hsa-miR-515-5p	CLIP-seq
MIRT1405283	hsa-miR-516b	CLIP-seq
MIRT1405284	hsa-miR-548u	CLIP-seq
MIRT1405285	hsa-miR-617	CLIP-seq
MIRT1405286	hsa-miR-626	CLIP-seq
MIRT1405287	hsa-miR-877	CLIP-seq
MIRT1405288	hsa-miR-106a	CLIP-seq
MIRT1405289	hsa-miR-106b	CLIP-seq
MIRT1405290	hsa-miR-1185	CLIP-seq
MIRT1405291	hsa-miR-1234	CLIP-seq
MIRT1405292	hsa-miR-1252	CLIP-seq
MIRT1405293	hsa-miR-1262	CLIP-seq
MIRT1405294	hsa-miR-1266	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT1405296	hsa-miR-129-5p	CLIP-seq
MIRT1405257	hsa-miR-1299	CLIP-seq
MIRT1405297	hsa-miR-1321	CLIP-seq
MIRT1405298	hsa-miR-1323	CLIP-seq
MIRT1405299	hsa-miR-143	CLIP-seq
MIRT1405300	hsa-miR-17	CLIP-seq
MIRT1405301	hsa-miR-186	CLIP-seq
MIRT1405302	hsa-miR-2052	CLIP-seq
MIRT1405303	hsa-miR-20a	CLIP-seq
MIRT1405304	hsa-miR-20b	CLIP-seq
MIRT1405259	hsa-miR-219-5p	CLIP-seq
MIRT1405305	hsa-miR-24	CLIP-seq
MIRT1405306	hsa-miR-2467-3p	CLIP-seq
MIRT1405307	hsa-miR-2467-5p	CLIP-seq
MIRT1405308	hsa-miR-302a	CLIP-seq
MIRT1405309	hsa-miR-302b	CLIP-seq
MIRT1405310	hsa-miR-302c	CLIP-seq
MIRT1405311	hsa-miR-302d	CLIP-seq
MIRT1405312	hsa-miR-302e	CLIP-seq
MIRT1405313	hsa-miR-3120-3p	CLIP-seq
MIRT1405314	hsa-miR-3120-5p	CLIP-seq
MIRT1405315	hsa-miR-3121-5p	CLIP-seq
MIRT1405316	hsa-miR-3133	CLIP-seq
MIRT1405317	hsa-miR-3159	CLIP-seq
MIRT1405318	hsa-miR-320e	CLIP-seq
MIRT1405319	hsa-miR-335	CLIP-seq
MIRT1405320	hsa-miR-3605-5p	CLIP-seq
MIRT1405321	hsa-miR-3609	CLIP-seq
MIRT1405322	hsa-miR-3664-3p	CLIP-seq
MIRT1405323	hsa-miR-3677-5p	CLIP-seq
MIRT1405324	hsa-miR-3679-5p	CLIP-seq
MIRT1405325	hsa-miR-3689d	CLIP-seq
MIRT1405326	hsa-miR-372	CLIP-seq
MIRT1405327	hsa-miR-373	CLIP-seq
MIRT1405328	hsa-miR-4268	CLIP-seq
MIRT1405329	hsa-miR-4270	CLIP-seq
MIRT1405330	hsa-miR-4276	CLIP-seq
MIRT1405331	hsa-miR-4320	CLIP-seq
MIRT1405332	hsa-miR-4419a	CLIP-seq
MIRT1405333	hsa-miR-4433	CLIP-seq
MIRT1405334	hsa-miR-4435	CLIP-seq
MIRT1405335	hsa-miR-4441	CLIP-seq
MIRT1405336	hsa-miR-4448	CLIP-seq
MIRT1405337	hsa-miR-4459	CLIP-seq
MIRT1405338	hsa-miR-4469	CLIP-seq
MIRT1405339	hsa-miR-4506	CLIP-seq
MIRT1405340	hsa-miR-4510	CLIP-seq
MIRT1405341	hsa-miR-4518	CLIP-seq
MIRT1405342	hsa-miR-4663	CLIP-seq
MIRT1405343	hsa-miR-4670-3p	CLIP-seq
MIRT1405344	hsa-miR-4679	CLIP-seq
MIRT1405345	hsa-miR-4699-5p	CLIP-seq
MIRT1405346	hsa-miR-4701-3p	CLIP-seq
MIRT1405347	hsa-miR-4708-5p	CLIP-seq
MIRT1405348	hsa-miR-4739	CLIP-seq
MIRT1405349	hsa-miR-4744	CLIP-seq
MIRT1405350	hsa-miR-4753-3p	CLIP-seq
MIRT1405351	hsa-miR-4756-5p	CLIP-seq
MIRT1405352	hsa-miR-4763-5p	CLIP-seq
MIRT1405353	hsa-miR-4768-3p	CLIP-seq
MIRT1405354	hsa-miR-4770	CLIP-seq
MIRT1405355	hsa-miR-4778-5p	CLIP-seq
MIRT1405277	hsa-miR-4782-3p	CLIP-seq
MIRT1405356	hsa-miR-4796-3p	CLIP-seq
MIRT1405357	hsa-miR-4797-5p	CLIP-seq
MIRT1405358	hsa-miR-510	CLIP-seq
MIRT1405281	hsa-miR-511	CLIP-seq
MIRT1405359	hsa-miR-512-3p	CLIP-seq
MIRT1405360	hsa-miR-514	CLIP-seq
MIRT1405361	hsa-miR-514b-3p	CLIP-seq
MIRT1405362	hsa-miR-519d	CLIP-seq
MIRT1405363	hsa-miR-520a-3p	CLIP-seq
MIRT1405364	hsa-miR-520b	CLIP-seq
MIRT1405365	hsa-miR-520c-3p	CLIP-seq
MIRT1405366	hsa-miR-520d-3p	CLIP-seq
MIRT1405367	hsa-miR-520e	CLIP-seq
MIRT1405368	hsa-miR-545	CLIP-seq
MIRT1405369	hsa-miR-548a-3p	CLIP-seq
MIRT1405370	hsa-miR-548ah	CLIP-seq
MIRT1405371	hsa-miR-548c-3p	CLIP-seq
MIRT1405372	hsa-miR-548e	CLIP-seq
MIRT1405373	hsa-miR-548f	CLIP-seq
MIRT1405374	hsa-miR-548o	CLIP-seq
MIRT1405375	hsa-miR-548p	CLIP-seq
MIRT1405376	hsa-miR-550a	CLIP-seq
MIRT1405377	hsa-miR-552	CLIP-seq
MIRT1405378	hsa-miR-593	CLIP-seq
MIRT1405285	hsa-miR-617	CLIP-seq
MIRT1405379	hsa-miR-622	CLIP-seq
MIRT1405380	hsa-miR-642a	CLIP-seq
MIRT1405381	hsa-miR-720	CLIP-seq
MIRT1405382	hsa-miR-764	CLIP-seq
MIRT1405383	hsa-miR-875-3p	CLIP-seq
MIRT1405384	hsa-miR-93	CLIP-seq
MIRT1405292	hsa-miR-1252	CLIP-seq
MIRT1554358	hsa-miR-1912	CLIP-seq
MIRT1554359	hsa-miR-3919	CLIP-seq
MIRT1554360	hsa-miR-4786-3p	CLIP-seq
MIRT1554361	hsa-miR-4795-5p	CLIP-seq
MIRT1554362	hsa-miR-501-3p	CLIP-seq
MIRT1554363	hsa-miR-502-3p	CLIP-seq
MIRT1554364	hsa-miR-671-5p	CLIP-seq
MIRT1554365	hsa-miR-711	CLIP-seq
MIRT2121574	hsa-miR-1275	CLIP-seq
MIRT2121575	hsa-miR-1468	CLIP-seq
MIRT2121576	hsa-miR-1909	CLIP-seq
MIRT2121577	hsa-miR-1913	CLIP-seq
MIRT2121578	hsa-miR-198	CLIP-seq
MIRT1405259	hsa-miR-219-5p	CLIP-seq
MIRT1405263	hsa-miR-2861	CLIP-seq
MIRT2121579	hsa-miR-3158-3p	CLIP-seq
MIRT2121580	hsa-miR-3183	CLIP-seq
MIRT2121581	hsa-miR-324-3p	CLIP-seq
MIRT2121582	hsa-miR-3661	CLIP-seq
MIRT1405266	hsa-miR-370	CLIP-seq
MIRT2121583	hsa-miR-3944-5p	CLIP-seq
MIRT2121584	hsa-miR-4428	CLIP-seq
MIRT2121585	hsa-miR-4525	CLIP-seq
MIRT2121586	hsa-miR-4665-5p	CLIP-seq
MIRT2121587	hsa-miR-4685-5p	CLIP-seq
MIRT2121588	hsa-miR-4699-3p	CLIP-seq
MIRT2121589	hsa-miR-4723-3p	CLIP-seq
MIRT2121590	hsa-miR-4723-5p	CLIP-seq
MIRT2121591	hsa-miR-4731-5p	CLIP-seq
MIRT2121592	hsa-miR-4749-3p	CLIP-seq
MIRT2121593	hsa-miR-4757-5p	CLIP-seq
MIRT1405277	hsa-miR-4782-3p	CLIP-seq
MIRT2121594	hsa-miR-625	CLIP-seq
MIRT2121595	hsa-miR-631	CLIP-seq
MIRT2121596	hsa-miR-637	CLIP-seq
MIRT2121597	hsa-miR-640	CLIP-seq
MIRT2121598	hsa-miR-769-5p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2121575	hsa-miR-1468	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT1405264	hsa-miR-3125	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460876	hsa-miR-3150b-3p	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT2121580	hsa-miR-3183	CLIP-seq
MIRT1405267	hsa-miR-3916	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2460879	hsa-miR-4476	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2121589	hsa-miR-4723-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460883	hsa-miR-4784	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2460885	hsa-miR-765	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2637265	hsa-miR-122	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT2637266	hsa-miR-149	CLIP-seq
MIRT1405305	hsa-miR-24	CLIP-seq
MIRT1405264	hsa-miR-3125	CLIP-seq
MIRT2637267	hsa-miR-3135b	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT1405318	hsa-miR-320e	CLIP-seq
MIRT2637268	hsa-miR-3622b-5p	CLIP-seq
MIRT2637269	hsa-miR-3647-3p	CLIP-seq
MIRT1405267	hsa-miR-3916	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2637270	hsa-miR-4284	CLIP-seq
MIRT2460879	hsa-miR-4476	CLIP-seq
MIRT2637271	hsa-miR-4645-5p	CLIP-seq
MIRT2637272	hsa-miR-4668-3p	CLIP-seq
MIRT2637273	hsa-miR-4673	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2637274	hsa-miR-760	CLIP-seq
MIRT2637265	hsa-miR-122	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT2637266	hsa-miR-149	CLIP-seq
MIRT1405305	hsa-miR-24	CLIP-seq
MIRT2637267	hsa-miR-3135b	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT1405318	hsa-miR-320e	CLIP-seq
MIRT2637268	hsa-miR-3622b-5p	CLIP-seq
MIRT2637269	hsa-miR-3647-3p	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2637270	hsa-miR-4284	CLIP-seq
MIRT2637271	hsa-miR-4645-5p	CLIP-seq
MIRT2637272	hsa-miR-4668-3p	CLIP-seq
MIRT2637273	hsa-miR-4673	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2637274	hsa-miR-760	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
JUN	Unknown	22354960

186

Show/Hide all (186)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001775	Process	Cell activation	IEA
GO:0001775	Process	Cell activation	ISS
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001820	Process	Serotonin secretion	IEA
GO:0001945	Process	Lymph vessel development	IEA
GO:0001945	Process	Lymph vessel development	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	ISS
GO:0002281	Process	Macrophage activation involved in immune response	IBA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	ISS
GO:0002283	Process	Neutrophil activation involved in immune response	IBA
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0002283	Process	Neutrophil activation involved in immune response	ISS
GO:0002366	Process	Leukocyte activation involved in immune response	IEA
GO:0002366	Process	Leukocyte activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002554	Process	Serotonin secretion by platelet	IEA
GO:0002554	Process	Serotonin secretion by platelet	ISS
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IMP	19358895
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004672	Function	Protein kinase activity	IDA	18818202
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	NAS	12885943
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	23071339
GO:0004713	Function	Protein tyrosine kinase activity	EXP	8629002, 8657103, 10648173, 17993265, 18818202, 22041900
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	34634301
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	33782605
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	NAS	28386764
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	8163536, 11606584
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IGI	14656219
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IMP	15509800
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IPI	31145836
GO:0005178	Function	Integrin binding	IPI	12885943
GO:0005515	Function	Protein binding	IPI	7761456, 8627166, 8647200, 8657103, 8798676, 8810294, 9280292, 9698567, 11940607, 12051764, 15536084, 16273093, 18273061, 19843936, 20133729, 20585042, 20713593, 21044950, 21516116, 22019427, 22624718, 23001182, 23299888, 24525236, 24728074, 25416956, 25605870, 25814554, 28086240, 31
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	23071339
GO:0005737	Component	Cytoplasm	IDA	23071339
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IC	8163536
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	IDA	17681949
GO:0006606	Process	Protein import into nucleus	IMP	23071339
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	12885943
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	12885943
GO:0009887	Process	Animal organ morphogenesis	TAS	7477352
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010508	Process	Positive regulation of autophagy	IDA	22017875, 22017876
GO:0010543	Process	Regulation of platelet activation	IEA
GO:0010543	Process	Regulation of platelet activation	ISS
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IMP	19151749
GO:0016020	Component	Membrane	IEA
GO:0016170	Function	Interleukin-15 receptor binding	IPI	15123770
GO:0016301	Function	Kinase activity	IDA	9490415
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019815	Component	B cell receptor complex	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019902	Function	Phosphatase binding	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0030183	Process	B cell differentiation	IEA
GO:0030593	Process	Neutrophil chemotaxis	IDA	12885943
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	22267217
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0031669	Process	Cellular response to nutrient levels	IDA	32561715
GO:0032009	Component	Early phagosome	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	19358895
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	19358895
GO:0032752	Process	Positive regulation of interleukin-3 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	19358895
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	25251945
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	19358895
GO:0032765	Process	Positive regulation of mast cell cytokine production	IEA
GO:0032928	Process	Regulation of superoxide anion generation	IEA
GO:0032928	Process	Regulation of superoxide anion generation	ISS
GO:0032930	Process	Positive regulation of superoxide anion generation	IMP	19358895
GO:0032991	Component	Protein-containing complex	IDA	23071339
GO:0032991	Component	Protein-containing complex	IEA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IBA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IEA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	ISS
GO:0035325	Function	Toll-like receptor binding	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	11606584, 15509800
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IGI	14656219
GO:0035556	Process	Intracellular signal transduction	IMP	11606584, 32514138
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IEA
GO:0038156	Process	Interleukin-3-mediated signaling pathway	ISS
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042101	Component	T cell receptor complex	IDA	8176201
GO:0042101	Component	T cell receptor complex	IEA
GO:0042169	Function	SH2 domain binding	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	ISS
GO:0043274	Function	Phospholipase binding	IPI	14656219, 32514138
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0043313	Process	Regulation of neutrophil degranulation	IEA
GO:0043313	Process	Regulation of neutrophil degranulation	ISS
GO:0043366	Process	Beta selection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IMP	18369315
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045780	Process	Positive regulation of bone resorption	IEA
GO:0045780	Process	Positive regulation of bone resorption	ISS
GO:0046638	Process	Positive regulation of alpha-beta T cell differentiation	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048514	Process	Blood vessel morphogenesis	ISS
GO:0050764	Process	Regulation of phagocytosis	IEA
GO:0050764	Process	Regulation of phagocytosis	ISS
GO:0050776	Process	Regulation of immune response	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050853	Process	B cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	15509800
GO:0050853	Process	B cell receptor signaling pathway	ISS
GO:0050900	Process	Leukocyte migration	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	IMP	23071339
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0071226	Process	Cellular response to molecule of fungal origin	IEA
GO:0071226	Process	Cellular response to molecule of fungal origin	ISS
GO:0071396	Process	Cellular response to lipid	IMP	32514138
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IMP	25251945
GO:0090237	Process	Regulation of arachidonate secretion	IEA
GO:0090237	Process	Regulation of arachidonate secretion	ISS
GO:0090330	Process	Regulation of platelet aggregation	IEA
GO:0090330	Process	Regulation of platelet aggregation	ISS
GO:0097110	Function	Scaffold protein binding	IPI	11606584
GO:0097190	Process	Apoptotic signaling pathway	IMP	22267217
GO:0097242	Process	Amyloid-beta clearance	IDA	27477018
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	29235464
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	22017875, 22017876
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	34634301
GO:1904646	Process	Cellular response to amyloid-beta	IDA	29518356
GO:1990858	Process	Cellular response to lectin	IEA
GO:1990858	Process	Cellular response to lectin	ISS

MIM	HGNC	e!Ensembl
600085	11491	ENSG00000165025

P43405

Protein name

Tyrosine-protein kinase SYK (EC 2.7.10.2) (Spleen tyrosine kinase) (p72-Syk)

Protein function

Non-receptor tyrosine kinase which mediates signal transduction downstream of a variety of transmembrane receptors including classical immunoreceptors like the B-cell receptor (BCR). Regulates several biological processes including innate and ad

PDB

1A81 , 1CSY , 1CSZ , 1XBA , 1XBB , 1XBC , 3BUW , 3EMG , 3FQE , 3FQH , 3FQS , 3SRV , 3TUB , 3TUC , 3TUD , 3VF8 , 3VF9 , 4DFL , 4DFN , 4F4P , 4FL1 , 4FL2 , 4FL3 , 4FYN , 4FYO , 4FZ6 , 4FZ7 , 4GFG , 4I0R , 4I0S , 4I0T , 4PUZ , 4PV0 , 4PX6 , 4RSS , 4RX7 , 4RX8 , 4RX9 , 4WNM , 4XG2 , 4XG3 , 4XG4 , 4XG6 , 4XG7 , 4XG8 , 4XG9 , 4YJO , 4YJP , 4YJQ , 4YJR , 4YJS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	15 → 92	SH2 domain	Domain
PF00017	SH2	168 → 244	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	371 → 626	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in hematopoietic cells (at protein level) (PubMed:8163536). Expressed in neutrophils (at protein level) (PubMed:15123770). Within the B-cell compartment, expressed from pro- and pre-B cells to plasma cells (PubMed:8163

Sequence

MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

Sequence length

635

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway Phospholipase D signaling pathway PI3K-Akt signaling pathway Osteoclast differentiation Platelet activation Neutrophil extracellular trap formation C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity B cell receptor signaling pathway Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis Tuberculosis Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Viral carcinogenesis		GPVI-mediated activation cascade FCGR activation Regulation of actin dynamics for phagocytic cup formation Role of phospholipids in phagocytosis DAP12 signaling Fc epsilon receptor (FCERI) signaling Role of LAT2/NTAL/LAB on calcium mobilization FCERI mediated MAPK activation FCERI mediated Ca+2 mobilization Integrin signaling Dectin-2 family Interleukin-2 signaling Regulation of signaling by CBL FCGR3A-mediated IL10 synthesis FCGR3A-mediated phagocytosis Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Arthritis	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911
Colitis	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911
Decreased circulating immunoglobulin concentration	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911
Immunodeficiency	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911
Immunodeficiency 82 with systemic inflammation	Likely pathogenic; Pathogenic	rs1827861920, rs1828636794	RCV002293255 RCV001527352
Skin rash	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs290223	RCV005903590
Cervical cancer	Benign	rs290223	RCV005903592
Hepatocellular carcinoma	Benign	rs290223, rs2126053	RCV005927774 RCV005927777
Joint swelling	Conflicting classifications of pathogenicity	rs1828636794	RCV001270908
Long QT syndrome	Likely benign	rs796052158	RCV000190148
Malignant lymphoma, large B-cell, diffuse	Benign	rs290223, rs2126053	RCV005927775 RCV005927778
Malignant tumor of esophagus	Benign	rs290223	RCV005903591
SYK-related disorder	Likely benign	rs138271353, rs772672206	RCV003914431 RCV003966879
Thymoma	Benign	rs290223	RCV005903593
Uterine carcinosarcoma	Benign	rs290223	RCV005927776

Show/Hide Text Mining Associations (138)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acrocephalosyndactylia	Stimulate	30898992
Adenocarcinoma of Lung	Associate	27461624, 35868661
Anemia Sickle Cell	Associate	11698299
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	36428281
Arthritis Rheumatoid	Associate	16452391, 38350168
Asthma	Associate	8590001
Atherosclerosis	Associate	22321643, 28260035
Autoimmune Diseases	Associate	25715120, 31616406, 37301715
Blood Platelet Disorders	Associate	29297721, 33267658, 35309299
Breast Neoplasms	Associate	11859072, 12477728, 17214368, 19435818, 20562096, 20628393, 22451900, 22864779, 23613720, 23684705, 23803121, 24523870, 24914616, 25092868, 26126114 View all (6 more)
Breast Neoplasms	Inhibit	15861514, 16431925, 19151749, 22864779, 24523870
Burkitt Lymphoma	Associate	28064214, 30617194, 33670716
Calcinosis Cutis	Inhibit	24523870
Calcinosis Cutis	Associate	30733195
Carcinogenesis	Associate	16431925, 19151749, 22864779, 25310533, 30091681
Carcinoma	Associate	28957395
Carcinoma Ductal	Inhibit	24523870
Carcinoma Ductal Breast	Inhibit	24523870
Carcinoma Hepatocellular	Associate	17121887, 25310533, 26045814, 28302680, 29209123, 32730361, 33638929, 34258170, 34634301
Carcinoma Intraductal Noninfiltrating	Inhibit	24523870
Carcinoma Non Small Cell Lung	Associate	27461628, 29578158, 37183231
Carcinoma Pancreatic Ductal	Associate	19893036
Carcinoma Small Cell	Associate	24564859
Carcinoma Squamous Cell	Associate	28423512
Cardiovascular Diseases	Associate	37301715
Carotid Stenosis	Associate	28260035
Cerebral Infarction	Associate	30499219
Chemical and Drug Induced Liver Injury	Associate	28957395
Chronic Urticaria	Associate	19477690, 29859965
Colonic Neoplasms	Associate	33979042
Colorectal Neoplasms	Associate	24308539, 25287946, 28957395, 29693170, 33979042
Combined Saposin Deficiency	Stimulate	30898992
Coronary Disease	Associate	30898992
COVID 19	Associate	34252574, 35309299, 36736734
Cytokine Release Syndrome	Associate	26036769
Dehydration	Associate	11698299
Dermatitis Atopic	Associate	30919407
Dermatitis Atopic 1	Associate	25113532
Diabetes Mellitus	Associate	12670344, 36736734
Diabetes Mellitus Type 2	Stimulate	36736734
Diabetic Angiopathies	Associate	35309299
Diabetic Nephropathies	Associate	31949205, 32778679
Drug Hypersensitivity	Associate	8590001
Drug Hypersensitivity Syndrome	Associate	39241232
Drug Related Side Effects and Adverse Reactions	Associate	26096845, 37301715
Drug Related Side Effects and Adverse Reactions	Inhibit	27720936
Fibrosis	Associate	33638929
Glioblastoma	Associate	37107600
Glioma	Associate	26245897
Glomerulonephritis	Associate	25715120
Glomerulonephritis IGA	Associate	25715120
Glomerulonephritis IGA	Stimulate	32954852
Granulosa Cell Tumor	Associate	14970867
Hematologic Neoplasms	Associate	25092868
Hematuria Benign Familial	Associate	25715120
Heparin Cofactor II Deficiency	Associate	21848694
Hepatitis B	Associate	33435587
Hereditary leiomyomatosis and renal cell cancer	Associate	16304050
Hidradenitis Suppurativa	Associate	32853177, 37922232
HIV Infections	Inhibit	29616021
Hodgkin Disease	Associate	12881301, 28791394
Hodgkin Disease	Inhibit	16304050
Hyperacusis	Associate	21876553
Hypoxia	Associate	37107600
Idiopathic Pulmonary Fibrosis	Associate	35130915
Immune System Diseases	Associate	39241232
Infections	Stimulate	25113532
Infections	Associate	36257313
Inflammation	Associate	25113532, 25202827, 25891413, 26036769, 30898992, 30919407, 33638929, 35563204, 35565057, 36078084
Influenza Human	Associate	36148221
Job Syndrome	Associate	39241232
Laryngeal Neoplasms	Associate	26884848
Leukemia	Associate	20014315, 26315286, 32015510
Leukemia B Cell	Associate	33435587
Leukemia Lymphocytic Chronic B Cell	Associate	12393534, 12393552, 15059847, 15514014, 16322480, 18048647, 20817072, 23072591, 24489640, 25170122, 25329694, 28036404, 28154084, 28570130, 29122990, 32784334, 34467417, 7620163 View all (3 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	26508782, 28011673
Leukemia Lymphoma Adult T Cell	Stimulate	19131553
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21730355, 28560425
Leukemia Myeloid Acute	Associate	12763134, 26315286, 26785729, 33592500, 34536536
Leukemia Prolymphocytic T Cell	Associate	31974418
Leukoencephalopathies	Associate	23412934, 38345145
Lung Neoplasms	Associate	23803069, 30251328, 34252536, 37183231
Lung Neoplasms	Inhibit	27461628
Lupus Erythematosus Cutaneous	Stimulate	33336508
Lupus Erythematosus Systemic	Associate	11352243, 19018007, 19201859, 21953500, 22235999, 24013589, 26582197, 37072752
Lupus Erythematosus Systemic	Stimulate	22354960
Lupus Nephritis	Associate	25715120
Lymphangioleiomyomatosis	Associate	35181635
Lymphatic Metastasis	Associate	15188513, 15861514, 26884848
Lymphedema	Associate	23613720
Lymphoma	Associate	32005797, 35255496
Lymphoma B Cell	Associate	16912221, 32005797, 33670716, 35255496
Lymphoma B Cell Marginal Zone	Associate	22110251, 23072591
Lymphoma Follicular	Associate	16835385, 16912221
Lymphoma Large B Cell Diffuse	Associate	18006696, 19855081, 21148756, 22025527, 23764004, 24169826, 26585955, 27720936, 28646116, 30534553, 31471373, 39914494
Lymphoma Large Cell Anaplastic	Associate	20511667
Lymphoma Mantle Cell	Associate	16409295, 21394647
Lymphoma Non Hodgkin	Associate	21148756
Lymphoma T Cell	Associate	22510872, 29052597
Lymphoma T Cell Peripheral	Associate	18401419, 19295409, 25337257, 34147695
Mammary Neoplasms Animal	Inhibit	24523870
Melanoma	Inhibit	19293188
Melanoma	Associate	36409827
Mesothelioma Malignant	Associate	17659810
Mouth Neoplasms	Associate	30091681
Multiple Sclerosis	Associate	23412934, 25526461
Myositis	Associate	25715120
Nasopharyngeal Carcinoma	Associate	16431925, 28827787
Neoplasm Metastasis	Associate	15188513, 19435818, 23803069, 24523870, 27461624, 30733195, 33979042
Neoplasm Metastasis	Inhibit	24914616, 26884848
Neoplasms	Associate	12881301, 16207477, 16835385, 19151749, 23447535, 23803069, 24914616, 25310533, 26315286, 26429917, 26884848, 27245195, 27461628, 29511377, 29643476 View all (7 more)
Neoplasms	Inhibit	14970867, 16431925, 17214368, 19293188, 19893036, 20562096, 22451900, 23803121, 24523870, 26889814, 28957395, 33670716, 36889573
Neoplasms	Stimulate	20585448
Neuroacanthocytosis	Associate	21951684
Osteoporosis	Associate	36937804
Osteosarcoma	Associate	35435107
Ovarian Diseases	Associate	14970867
Ovarian Neoplasms	Associate	26096845, 29643476, 30668583, 30737623, 32878513
Pain	Associate	32213162
Papillomavirus Infections	Associate	30091681
Plaque Atherosclerotic	Stimulate	26742467
Plaque Atherosclerotic	Associate	28260035
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	33435587
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16192589, 25974135, 32015510
Prostatic Neoplasms	Associate	22219177
Pulmonary Disease Chronic Obstructive	Associate	32099002
Schizophrenia	Associate	24564241
Skin Diseases	Associate	25202827
Small Cell Lung Carcinoma	Associate	24564859
Squamous Cell Carcinoma of Head and Neck	Associate	24398980, 30091681
Squamous Cell Carcinoma of Head and Neck	Inhibit	26884848
ST Elevation Myocardial Infarction	Stimulate	30898992
Stomach Neoplasms	Inhibit	15188513
Tertiary Lymphoid Structures	Associate	28957395
Tooth Erosion	Associate	30674869
Vasculitis	Associate	36428281
Waldenstrom Macroglobulinemia	Associate	25748087, 30402490
Wounds and Injuries	Associate	33638929

SYK (spleen associated tyrosine kinase)