Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	683
Gene name	Bone marrow stromal cell antigen 1
Gene symbol	BST1
Synonyms (NCBI Gene)	CD157cADPR2
Chromosome	4
Chromosome location	4p15.32
Summary	Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone mar

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT738077	hsa-miR-2276	HITS-CLIP	33718276
MIRT738081	hsa-miR-579	HITS-CLIP	33718276
MIRT826169	hsa-miR-203	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NFKB1	Unknown	9030974

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001931	Component	Uropod	IDA	15328157
GO:0001952	Process	Regulation of cell-matrix adhesion	IDA	15328157
GO:0002691	Process	Regulation of cellular extravasation	TAS	23576305
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8202488
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006959	Process	Humoral immune response	IC	8202488
GO:0007165	Process	Signal transduction	TAS	23576305
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8202488
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IBA
GO:0030890	Process	Positive regulation of B cell proliferation	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	15328157
GO:0035579	Component	Specific granule membrane	TAS
GO:0050727	Process	Regulation of inflammatory response	IDA	15328157
GO:0050848	Process	Regulation of calcium-mediated signaling	IMP	15328157
GO:0050848	Process	Regulation of calcium-mediated signaling	TAS	23576305
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IDA	7805847, 11866528
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090022	Process	Regulation of neutrophil chemotaxis	IDA	15328157
GO:0090322	Process	Regulation of superoxide metabolic process	TAS	23576305
GO:0098552	Component	Side of membrane	IEA
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	TAS	23576305

MIM	HGNC	e!Ensembl
600387	1118	ENSG00000109743

Q10588

Protein name

ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 (EC 3.2.2.6) (ADP-ribosyl cyclase 2) (Bone marrow stromal cell antigen 1) (BST-1) (Cyclic ADP-ribose hydrolase 2) (cADPR hydrolase 2) (CD antigen CD157)

Protein function

Catalyzes both the synthesis of cyclic ADP-beta-D-ribose (cADPR) from NAD(+), and its hydrolysis to ADP-D-ribose (ADPR) (PubMed:7805847). Cyclic ADPR is known to serve as an endogenous second messenger that elicits calcium release from intracell

PDB

1ISF , 1ISG , 1ISH , 1ISI , 1ISJ , 1ISM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02267	Rib_hydrolayse	40 → 280	ADP-ribosyl cyclase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various tissues including placenta, lung, liver and kidney. {ECO:0000269|PubMed:8202488}.

Sequence

MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSP
EQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFA
DNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYS
KDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGE
GSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQ
RAGLIIPLFLVLASRTQL

Sequence length

318

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Salivary secretion Pancreatic secretion		Post-translational modification: synthesis of GPI-anchored proteins Nicotinate metabolism Neutrophil degranulation

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Lung cancer	Benign	rs34163939	RCV005903337
Nonpapillary renal cell carcinoma	Benign	rs34163939	RCV005903334
Sarcoma	Benign	rs34163939	RCV005903335
Thymoma	Benign	rs34163939	RCV005903336
Uterine corpus endometrial carcinoma	Benign	rs34163939	RCV005903338

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	9691097
Asthma	Associate	24634087
Attention Deficit Disorder with Hyperactivity	Associate	33155823
Autistic Disorder	Associate	24634087
Calcinosis Cutis	Associate	22916288
Carcinoma Ovarian Epithelial	Associate	20639476, 22916288
Cerebral Infarction	Associate	25135788
Cognition Disorders	Associate	30656857
Drug Related Side Effects and Adverse Reactions	Associate	34707185
Gait Ataxia	Associate	30676692
Gait Disorders Neurologic	Associate	30676692
Gout	Associate	33155823
Heart Diseases	Associate	30676692
Hemoglobinuria Paroxysmal	Associate	15328157, 23922226, 29360268, 31571381
Inflammation	Associate	15328157, 20639476, 36926335
Ischemic Stroke	Associate	25135788
Leukemia Myeloid Acute	Associate	28415689, 34707185
Mesothelioma Malignant	Associate	25026285
Neoplasms	Associate	22916288, 39291803
Osteosarcoma	Associate	40165145
Ovarian Neoplasms	Associate	20639476, 25026285, 36528667
Parkinson Disease	Associate	21044948, 21248740, 21812969, 22786590, 26469904, 27299523, 30676692, 33349842, 36926335
Parkinson Disease	Inhibit	22786590
Parkinson Disease	Stimulate	36926335
Prostatic Neoplasms	Stimulate	29695737
REM Sleep Behavior Disorder	Associate	33397775
ST Elevation Myocardial Infarction	Associate	35475279
Stroke	Associate	25135788
Wolf Hirschhorn Syndrome	Associate	29721507

BST1 (bone marrow stromal cell antigen 1)