Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6811
Gene name Gene Name - the full gene name approved by the HGNC.
Syntaxin 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STX5
Synonyms (NCBI Gene) Gene synonyms aliases
CDG2AA, SED5, STX5A
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for v-SNAREs (vesicle-SNAP receptors), permitting specific synaptic vesicle docking and fusion. The en
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021024 hsa-miR-155-5p Proteomics 18668040
MIRT1401051 hsa-miR-3163 CLIP-seq
MIRT1401052 hsa-miR-3681 CLIP-seq
MIRT1401053 hsa-miR-4261 CLIP-seq
MIRT1401054 hsa-miR-548c-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0000149 Function SNARE binding IBA
GO:0005484 Function SNAP receptor activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603189 11440 ENSG00000162236
Protein
UniProt ID Q13190
Protein name Syntaxin-5
Protein function Mediates endoplasmic reticulum to Golgi transport. Together with p115/USO1 and GM130/GOLGA2, involved in vesicle tethering and fusion at the cis-Golgi membrane to maintain the stacked and inter-connected structure of the Golgi apparatus. {ECO:00
PDB 3EFO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11416 Syntaxin-5_N 52 74 Syntaxin-5 N-terminal, Sly1p-binding domain Family
PF05739 SNARE 299 351 SNARE domain Family
Sequence
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDR
TQEFLSACKSLQTR
QNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHAS
KDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFV
VFLA
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  SNARE interactions in vesicular transport   COPII-mediated vesicle transport
Cargo concentration in the ER
COPI-mediated anterograde transport
Intra-Golgi traffic
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Congenital disorder of glycosylation congenital disorder of glycosylation, type IIaa N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 31952466
Lysosomal Storage Diseases Associate 21242315
Prosopagnosia Associate 35262690
Spondyloepiphyseal Dysplasia Tarda Autosomal Recessive Associate 23898804
Unverricht Lundborg Syndrome Associate 28982678