Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6756
Gene name Gene Name - the full gene name approved by the HGNC.
SSX family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SSX1
Synonyms (NCBI Gene) Gene synonyms aliases
CT5.1, SPGFX5, SSRC
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.23
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune respons
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025895 hsa-miR-7-5p Microarray 17612493
MIRT1392930 hsa-miR-134 CLIP-seq
MIRT1392931 hsa-miR-223 CLIP-seq
MIRT1392932 hsa-miR-3118 CLIP-seq
MIRT1392933 hsa-miR-3136-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10072425
GO:0003714 Function Transcription corepressor activity IMP 10072425
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 10072425
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
312820 11335 ENSG00000126752
Protein
UniProt ID Q16384
Protein name Protein SSX1 (Cancer/testis antigen 5.1) (CT5.1) (Synovial sarcoma, X breakpoint 1)
Protein function Could act as a modulator of transcription (PubMed:7539744). Plays a role in spermatogenesis (PubMed:36796361).
PDB 8HR1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 22 62 KRAB box Family
PF09514 SSXRD 157 187 SSXRD motif Motif
Tissue specificity TISSUE SPECIFICITY: Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detecte
Sequence
MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTK
LG
FKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE
NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEI
SDPEEDD
E
Sequence length 188
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Transcriptional misregulation in cancer  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Spermatogenic Failure, X-Linked spermatogenic failure, X-linked, 5 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 20576167
Carcinoma Hepatocellular Associate 15237429, 17186289
Carcinoma Squamous Cell Associate 34177903
Colorectal Neoplasms Associate 15756003
Colorectal Neoplasms Stimulate 37241221
Inflammation Associate 23020131
Melanoma Associate 17186289, 23020131
Multiple Myeloma Associate 17023585, 17186289, 18237105, 20108890
Neoplasm Metastasis Associate 19385976
Neoplasms Associate 10879732, 15641030, 16929165, 17186289, 18296877, 19385976, 20731022, 23138873, 24798046, 34504309, 34895269, 9428816, 9846971