Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6755
Gene name Gene Name - the full gene name approved by the HGNC.	Somatostatin receptor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SSTR5
Synonyms (NCBI Gene) Gene synonyms aliases	SS-5-R, SST5
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membran

Show/Hide all(60)

miRTarBase ID	miRNA	Experiments
MIRT1392875	hsa-let-7a	CLIP-seq
MIRT1392876	hsa-let-7b	CLIP-seq
MIRT1392877	hsa-let-7c	CLIP-seq
MIRT1392878	hsa-let-7d	CLIP-seq
MIRT1392879	hsa-let-7e	CLIP-seq
MIRT1392880	hsa-let-7f	CLIP-seq
MIRT1392881	hsa-let-7g	CLIP-seq
MIRT1392882	hsa-let-7i	CLIP-seq
MIRT1392883	hsa-miR-1197	CLIP-seq
MIRT1392884	hsa-miR-125a-5p	CLIP-seq
MIRT1392885	hsa-miR-125b	CLIP-seq
MIRT1392886	hsa-miR-1275	CLIP-seq
MIRT1392887	hsa-miR-2467-3p	CLIP-seq
MIRT1392888	hsa-miR-3170	CLIP-seq
MIRT1392889	hsa-miR-342-5p	CLIP-seq
MIRT1392890	hsa-miR-4260	CLIP-seq
MIRT1392891	hsa-miR-4319	CLIP-seq
MIRT1392892	hsa-miR-4447	CLIP-seq
MIRT1392893	hsa-miR-4458	CLIP-seq
MIRT1392894	hsa-miR-4472	CLIP-seq
MIRT1392895	hsa-miR-4500	CLIP-seq
MIRT1392896	hsa-miR-4525	CLIP-seq
MIRT1392897	hsa-miR-4649-3p	CLIP-seq
MIRT1392898	hsa-miR-4651	CLIP-seq
MIRT1392899	hsa-miR-4664-5p	CLIP-seq
MIRT1392900	hsa-miR-4665-5p	CLIP-seq
MIRT1392901	hsa-miR-4723-5p	CLIP-seq
MIRT1392902	hsa-miR-4732-3p	CLIP-seq
MIRT1392903	hsa-miR-544b	CLIP-seq
MIRT1392904	hsa-miR-608	CLIP-seq
MIRT1392905	hsa-miR-615-5p	CLIP-seq
MIRT1392906	hsa-miR-625	CLIP-seq
MIRT1392907	hsa-miR-670	CLIP-seq
MIRT1392908	hsa-miR-98	CLIP-seq
MIRT2117917	hsa-miR-1285	CLIP-seq
MIRT2117918	hsa-miR-3187-5p	CLIP-seq
MIRT2117919	hsa-miR-378g	CLIP-seq
MIRT2117920	hsa-miR-4486	CLIP-seq
MIRT2117921	hsa-miR-612	CLIP-seq
MIRT2339888	hsa-miR-1291	CLIP-seq
MIRT2339889	hsa-miR-214	CLIP-seq
MIRT2339890	hsa-miR-3144-5p	CLIP-seq
MIRT2339891	hsa-miR-3619-5p	CLIP-seq
MIRT2339892	hsa-miR-4435	CLIP-seq
MIRT2339893	hsa-miR-761	CLIP-seq
MIRT2460575	hsa-miR-3183	CLIP-seq
MIRT2460576	hsa-miR-3197	CLIP-seq
MIRT2460577	hsa-miR-339-5p	CLIP-seq
MIRT2460578	hsa-miR-3909	CLIP-seq
MIRT2460579	hsa-miR-4316	CLIP-seq
MIRT2460580	hsa-miR-4534	CLIP-seq
MIRT2460581	hsa-miR-4640-5p	CLIP-seq
MIRT2460582	hsa-miR-4710	CLIP-seq
MIRT2460583	hsa-miR-4723-3p	CLIP-seq
MIRT2460584	hsa-miR-4725-5p	CLIP-seq
MIRT2460585	hsa-miR-4726-5p	CLIP-seq
MIRT1392902	hsa-miR-4732-3p	CLIP-seq
MIRT2460586	hsa-miR-4802-5p	CLIP-seq
MIRT2460587	hsa-miR-504	CLIP-seq
MIRT2460588	hsa-miR-515-5p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	IBA
GO:0004994	Function	Somatostatin receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	TAS	9892014
GO:0005515	Function	Protein binding	IPI	15247250, 18653781, 19426801
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7908405
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9892014
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7908405
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9892014
GO:0016020	Component	Membrane	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0050796	Process	Regulation of insulin secretion	IBA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IBA

MIM	HGNC	e!Ensembl
182455	11334	ENSG00000162009

Protein

UniProt ID

P35346

Protein name

Somatostatin receptor type 5 (SS-5-R) (SS5-R) (SS5R) (SST5)

Protein function

Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization. {EC

PDB

8X8L , 8X8N , 8ZBE , 8ZCJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 304	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary. {ECO:0000269|PubMed:12072395, ECO:0000269

Sequence

MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL

Sequence length

364

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Growth hormone synthesis, secretion and action		Peptide ligand-binding receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer specific mortality in estrogen receptor negative breast cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Polycystic Ovary Syndrome	Polycystic ovary syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (58)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acromegaly	Associate	21744088, 21810856, 28434012, 39201352
ACTH Secreting Pituitary Adenoma	Associate	17159301, 19318729
Adenocarcinoma	Associate	33024199
Adenoma	Associate	25536318, 34471015
Atherosclerosis	Associate	29685964
Carcinoid Tumor	Associate	11772967, 9484822
Carcinoma Hepatocellular	Associate	29282035, 31236404, 31638225
Carcinoma Merkel Cell	Associate	37540574
Carcinoma Ovarian Epithelial	Associate	39519394
Cholangiocarcinoma	Associate	29282035
Colonic Neoplasms	Stimulate	16610049
Colorectal Neoplasms	Associate	16610049
Crohn Disease	Associate	20150960, 21383526
Esophageal Neoplasms	Associate	36726845
Esophageal Squamous Cell Carcinoma	Associate	35578166
Gallbladder Neoplasms	Associate	23991955
Gastro enteropancreatic neuroendocrine tumor	Associate	26028102
Glioblastoma	Associate	35163067
Glucagonoma	Associate	8132773
Growth Hormone Deficiency With Pituitary Anomalies	Associate	26391562
Growth Hormone Secreting Pituitary Adenoma	Associate	20464704, 21744088, 26607296, 30078825, 34601790
Hematologic Diseases	Associate	33297556
Hyperaldosteronism	Associate	34690553
Hyperpituitarism	Associate	17420609
Hypothyroidism	Associate	28397723, 28434012
Insulinoma	Associate	20686293
Kidney Diseases	Associate	18443363
Laryngeal Neoplasms	Inhibit	31196171
Lymphoma Mantle Cell	Associate	28059098
Meningioma	Associate	26722517, 33899156
Neoplasm Metastasis	Associate	16508627, 31196171, 32495873, 39519394
Neoplasms	Associate	11772967, 17159301, 17420609, 20032567, 21744088, 26722517, 27875519, 28397723, 29282035, 30078825, 31381461, 32429652, 33491286, 33990938, 34601790, 35163067, 35603200, 37540574, 9062398 View all (4 more)
Neuroendocrine Tumors	Associate	20529830, 20682006, 23236542, 26447992, 26673010, 27622342, 34601790, 39682758
Neuroma Acoustic	Associate	14747443
Non functioning pancreatic endocrine tumor	Associate	23211371
Pancreatic Neoplasms	Associate	21692047, 22136833, 25890201
Pancreatitis	Associate	22136833, 25890201
Parkinson Disease	Associate	26889637
Peritonitis	Associate	39519394
Personality Disorders	Associate	26673010, 34601790
Pituitary ACTH Hypersecretion	Stimulate	19318729
Pituitary ACTH Hypersecretion	Associate	34471015
Pituitary Neoplasms	Associate	20464704, 25536318, 34674191, 39202532
Polycystic Kidney Autosomal Dominant	Associate	21744088
Polycystic Kidney Diseases	Associate	31176519
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	33297556
Prostatic Neoplasms	Associate	21151154, 23341348
Prostatic Neoplasms Castration Resistant	Stimulate	35899879
Rhabdomyosarcoma	Associate	33297556
Spherocytosis Hereditary	Associate	33297556
Squamous Cell Carcinoma of Head and Neck	Inhibit	31196171
Stomach Neoplasms	Associate	32495873
Thyroid Neoplasms	Associate	10768564, 24465589
Thyroiditis	Associate	23672766
Trochlear Nerve Diseases	Associate	35955756
Uveal melanoma	Associate	29949880
von Hippel Lindau Disease	Associate	28094316
Warburg Sjo Fledelius syndrome	Associate	39202532

SSTR5 (somatostatin receptor 5)