Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	671
Gene name Gene Name - the full gene name approved by the HGNC.	Bactericidal permeability increasing protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BPI
Synonyms (NCBI Gene) Gene synonyms aliases	BPIFD1, rBPI
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms. [provided by RefSeq, Nov 2014]

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
RUNX1	Unknown	14623259
SP3	Unknown	14623259
SPI1	Unknown	14623259

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA	21873635
GO:0001530	Function	Lipopolysaccharide binding	IDA	8409400
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0016020	Component	Membrane	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA	21873635
GO:0032715	Process	Negative regulation of interleukin-6 production	IBA	21873635
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	8409400
GO:0032717	Process	Negative regulation of interleukin-8 production	IBA	21873635
GO:0032717	Process	Negative regulation of interleukin-8 production	IDA	8409400
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IBA	21873635
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	8409400
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0035580	Component	Specific granule lumen	TAS
GO:0043031	Process	Negative regulation of macrophage activation	IBA	21873635
GO:0043031	Process	Negative regulation of macrophage activation	IDA	8409400
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
109195	1095	ENSG00000101425

Protein

UniProt ID

P17213

Protein name

Bactericidal permeability-increasing protein (BPI) (CAP 57)

Protein function

The cytotoxic action of BPI is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram

PDB

1BP1 , 1EWF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01273	LBP_BPI_CETP	44 → 259	LBP / BPI / CETP family, N-terminal domain	Family
PF02886	LBP_BPI_CETP_C	249 → 486	LBP / BPI / CETP family, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Restricted to cells of the myeloid series.

Sequence

MRENMARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKEL
KRIKIPDYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISG
KWKAQKRFLKMSGNFDLSIEGMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKS
KVGWLIQLFHKKIESALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGINYGL
VAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLV
YQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQ
PTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLF
GADVVYK

Sequence length

487

Interactions

View interactions

	Reactome
			Toll Like Receptor 4 (TLR4) Cascade Neutrophil degranulation Antimicrobial peptides

BPI (bactericidal permeability increasing protein)