BPI (bactericidal permeability increasing protein)

Gene Gene information from NCBI Gene database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 671
Gene name Bactericidal permeability increasing protein
Gene symbol BPI
Synonyms (NCBI Gene)
BPIFD1rBPI
Chromosome 20
Chromosome location 20q11.23
Summary This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms. [provided by RefSeq, Nov 2014]
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
RUNX1 Unknown 14623259
SP3 Unknown 14623259
SPI1 Unknown 14623259
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (30)
GO ID Ontology Definition Evidence Reference
GO:0001530 Function Lipopolysaccharide binding IBA
GO:0001530 Function Lipopolysaccharide binding IDA 8409400
GO:0002376 Process Immune system process IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
109195 1095 ENSG00000101425
Protein Protein information from UniProt database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17213
Protein name Bactericidal permeability-increasing protein (BPI) (CAP 57)
Protein function The cytotoxic action of BPI is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram
PDB 1BP1 , 1EWF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01273 LBP_BPI_CETP 44 → 259 LBP / BPI / CETP family, N-terminal domain Family
PF02886 LBP_BPI_CETP_C 249 → 486 LBP / BPI / CETP family, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Restricted to cells of the myeloid series.
Sequence 
MRENMARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKEL
KRIKIPDYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISG
KWKAQKRFLKMSGNFDLSIEGMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKS
KVGWLIQLFHKKIESALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGINYGL
VAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLV
YQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQ
PTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLF
GADVVYK
Sequence length 487
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Toll Like Receptor 4 (TLR4) Cascade
Neutrophil degranulation
Antimicrobial peptides
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs150340828 RCV005902715
Cervical cancer Likely benign rs137967923 RCV005907268
Familial cancer of breast Benign rs150340828 RCV005902714
Show/Hide Text Mining Associations (36)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 31249574
Bacterial Infections Associate 12869032, 24107515
Bipolar Disorder Associate 19319892, 37147304
Bipolar Disorder Stimulate 8917544
Bronchopulmonary Dysplasia Associate 37839510
Cognition Disorders Associate 26273683
Colitis Ulcerative Associate 26228368
Crohn Disease Associate 26228368
Cystic Fibrosis Associate 16861658, 19443536, 26273683, 37461324
Graft Occlusion Vascular Associate 33259239