Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6670
Gene name Gene Name - the full gene name approved by the HGNC.
Sp3 transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SP3
Synonyms (NCBI Gene) Gene synonyms aliases
SPR2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002402 hsa-miR-27a-3p Western blot 18006846
MIRT006249 hsa-miR-223-3p Luciferase reporter assay, Western blot 22080513
MIRT022933 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT002402 hsa-miR-27a-3p Western blot;qRT-PCR 20382698
MIRT042140 hsa-miR-484 CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
MYB Unknown 18342022
NF1 Unknown 18342022
NFYA Activation 16024108
SP1 Activation 16024108
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 14979875
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601804 11208 ENSG00000172845
Protein
UniProt ID Q02447
Protein name Transcription factor Sp3 (SPR-2)
Protein function Transcriptional factor that can act as an activator or repressor depending on isoform and/or post-translational modifications. Binds to GT and GC boxes promoter elements. Competes with SP1 for the GC-box promoters. Weak activator of transcriptio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 621 645 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 651 675 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 681 703 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence
MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLA
LLAATCSKIGPPSPGDDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIK
DEAGNLVQIPSAATSSGQYVLPLQNLQNQQIFSVAPGSDSSNGTVSSVQYQVIPQIQSAD
GQQVQIGFTGSSDNGGINQESSQIQIIPGSNQTLLASGTPSANIQNLIPQTGQVQVQGVA
IGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSGSSQTMTAGINADGHLINTG
QAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSS
GQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQT
IHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQ
NTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGE
NADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVAC
TCPNCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGK
RFTRSDELQRHRRTH
TGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVE
AARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSGNETM
E
Sequence length 781
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of transcription factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple myeloma Multiple myeloma N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36889558
Astrocytoma Associate 26689994
Atypical Squamous Cells of the Cervix Associate 19309563
Breast Neoplasms Associate 12176973, 12733991, 12837748, 15987735, 17511886
Carcinoma Hepatocellular Associate 26317792
Colonic Diseases Associate 21156786
Colonic Neoplasms Associate 26807725
Colorectal Neoplasms Associate 11027677, 20068171, 21156786, 21919647, 23194063, 24948597, 37786278
Congenital myasthenic syndrome ib Associate 12393509
Diabetes Mellitus Type 2 Associate 29207083