Gene Gene information from NCBI Gene database.
Entrez ID 6667
Gene name Sp1 transcription factor
Gene symbol SP1
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q13.13
Summary The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, re
miRNA miRNA information provided by mirtarbase database.
1325
miRTarBase ID miRNA Experiments Reference
MIRT002403 hsa-miR-27a-3p Western blot 18006846
MIRT000445 hsa-miR-29b-3p qRT-PCRChIPWestern blot 20385359
MIRT000445 hsa-miR-29b-3p Luciferase reporter assay 19211935
MIRT004246 hsa-miR-218-5p ImmunoblotLuciferase reporter assayqRT-PCR 19913496
MIRT000445 hsa-miR-29b-3p ImmunoblotLuciferase reporter assayqRT-PCR 19913496
Transcription factors Transcription factors information provided by TRRUST V2 database.
13
Transcription factor Regulation Reference
ATM Repression 11466608
ATM Unknown 12926986
CDX2 Unknown 22580340
ESR1 Unknown 19652226
HDAC1 Repression 21636851
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
67
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 15831516, 19307576, 21659522, 27030318
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 14701757
GO:0000976 Function Transcription cis-regulatory region binding IDA 18293083, 18850004
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
189906 11205 ENSG00000185591
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P08047
Protein name Transcription factor Sp1
Protein function Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of pr
PDB 1SP1 , 1SP2 , 1VA1 , 1VA2 , 1VA3 , 6PV0 , 6PV1 , 6PV2 , 6PV3 , 6UCO , 6UCP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 626 650 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 656 680 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 686 708 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Up-regulated in adenocarcinomas of the stomach (at protein level). Isoform 3 is ubiquitously expressed at low levels. {ECO:0000269|PubMed:21798247}.
Sequence
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS
KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ
TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG
LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT
SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS
GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ
TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS
GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW
SYCGKRFTRSDELQRHKRTH
TGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS
VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI
SGNGF
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocrine resistance
Mitophagy - animal
TGF-beta signaling pathway
Estrogen signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Huntington disease
Spinocerebellar ataxia
Human cytomegalovirus infection
Pathways in cancer
Transcriptional misregulation in cancer
Breast cancer
Choline metabolism in cancer
Diabetic cardiomyopathy
  PPARA activates gene expression
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Activation of gene expression by SREBF (SREBP)
Oncogene Induced Senescence
RNA polymerase II transcribes snRNA genes
Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Likely benign rs201324612 RCV005902923
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 33579314
Alopecia Areata Associate 33370782
Alzheimer Disease Associate 31545826
Atherosclerosis Associate 36071548
Bone Diseases Metabolic Associate 15466008
Bone Marrow Failure Disorders Associate 32636268
Breast Neoplasms Associate 16204032, 16260418, 22728919, 27572271, 28990063
Breast Neoplasms Inhibit 40666524
Carcinogenesis Associate 29948615, 33125142
Carcinoma Adenoid Cystic Associate 28631560