Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6667
Gene name Gene Name - the full gene name approved by the HGNC.
Sp1 transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SP1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, re
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002403 hsa-miR-27a-3p Western blot 18006846
MIRT000445 hsa-miR-29b-3p qRT-PCR, ChIP, Western blot 20385359
MIRT000445 hsa-miR-29b-3p Luciferase reporter assay 19211935
MIRT004246 hsa-miR-218-5p Immunoblot, Luciferase reporter assay, qRT-PCR 19913496
MIRT000445 hsa-miR-29b-3p Immunoblot, Luciferase reporter assay, qRT-PCR 19913496
Transcription factors
Transcription factor Regulation Reference
ATM Repression 11466608
ATM Unknown 12926986
CDX2 Unknown 22580340
ESR1 Unknown 19652226
HDAC1 Repression 21636851
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 15831516, 19307576, 21659522, 27030318
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 14701757
GO:0000976 Function Transcription cis-regulatory region binding IDA 18293083, 18850004
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
189906 11205 ENSG00000185591
Protein
UniProt ID P08047
Protein name Transcription factor Sp1
Protein function Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of pr
PDB 1SP1 , 1SP2 , 1VA1 , 1VA2 , 1VA3 , 6PV0 , 6PV1 , 6PV2 , 6PV3 , 6UCO , 6UCP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 626 650 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 656 680 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 686 708 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Up-regulated in adenocarcinomas of the stomach (at protein level). Isoform 3 is ubiquitously expressed at low levels. {ECO:0000269|PubMed:21798247}.
Sequence
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS
KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ
TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG
LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT
SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS
GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ
TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS
GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW
SYCGKRFTRSDELQRHKRTH
TGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS
VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI
SGNGF
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocrine resistance
Mitophagy - animal
TGF-beta signaling pathway
Estrogen signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Huntington disease
Spinocerebellar ataxia
Human cytomegalovirus infection
Pathways in cancer
Transcriptional misregulation in cancer
Breast cancer
Choline metabolism in cancer
Diabetic cardiomyopathy
  PPARA activates gene expression
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Activation of gene expression by SREBF (SREBP)
Oncogene Induced Senescence
RNA polymerase II transcribes snRNA genes
Estrogen-dependent gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Osteoporosis Osteoporosis N/A N/A GWAS
Progressive Supranuclear Palsy Progressive supranuclear palsy N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 33579314
Alopecia Areata Associate 33370782
Alzheimer Disease Associate 31545826
Atherosclerosis Associate 36071548
Bone Diseases Metabolic Associate 15466008
Bone Marrow Failure Disorders Associate 32636268
Breast Neoplasms Associate 16204032, 16260418, 22728919, 27572271, 28990063
Breast Neoplasms Inhibit 40666524
Carcinogenesis Associate 29948615, 33125142
Carcinoma Adenoid Cystic Associate 28631560