Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6640
Gene name Gene Name - the full gene name approved by the HGNC.
Syntrophin alpha 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNTA1
Synonyms (NCBI Gene) Gene synonyms aliases
LQT12, SNT1, TACIP1, dJ1187J4.5
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
Syntrophins are cytoplasmic peripheral membrane scaffold proteins that are components of the dystrophin-associated protein complex. This gene is a member of the syntrophin gene family and encodes the most common syntrophin isoform found in cardiac tissues
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs56157422 G>A,C,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Coding sequence variant, missense variant
rs121434500 G>A Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs139532210 C>G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign, benign Intron variant
rs141724500 G>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Coding sequence variant, missense variant
rs144860423 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022575 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002027 Process Regulation of heart rate IMP 18591664
GO:0003779 Function Actin binding IEA
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 9356463, 10212242, 16192269, 16533813, 18468998, 19931615, 26617989, 27382054, 28514442, 33961781
GO:0005516 Function Calmodulin binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601017 11167 ENSG00000101400
Protein
UniProt ID Q13424
Protein name Alpha-1-syntrophin (59 kDa dystrophin-associated protein A1 acidic component 1) (Pro-TGF-alpha cytoplasmic domain-interacting protein 1) (TACIP1) (Syntrophin-1)
Protein function Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the extracellular matrix via the dystrophin glycoprotein complex. Plays
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 87 167 PDZ domain Domain
PF18012 PH_17 208 266 PH domain Domain
PF00169 PH 294 401 PH domain Domain
Tissue specificity TISSUE SPECIFICITY: High expression in skeletal muscle and heart. Low expression in brain, pancreas, liver, kidney and lung. Not detected in placenta.
Sequence
MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQE
PAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKG
LAADQTEALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVVLEVK
YMKDVSPYFKNST
GGTSVGWDSPPASPLQRQPSSPGPTPRNFSEAKHMSLKMAYVSKRCTPNDPEPRYLEICS
ADGQDTLFLRAKDEASARSWATAIQA
QVNTLTPRVKDELQALLAATSTAGSQDIKQIGWL
TEQLPSGGTAPTLALLTEKELLLYLSLPETREALSRPARTAPLIATRLVHSGPSKGSVPY
DAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCH
RAAEGVQEVSTACTWNGRP
CSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLH
SCPKTIVFIIHSFLSAKVTRLGLLA
Sequence length 505
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytoskeleton in muscle cells
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
Viral myocarditis
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Becker Muscular Dystrophy becker muscular dystrophy N/A N/A ClinVar
Brugada Syndrome brugada syndrome N/A N/A ClinVar
Carcinoma Basal cell carcinoma N/A N/A GWAS
Cardiomyopathy Primary dilated cardiomyopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arrhythmias Cardiac Inhibit 35762211
Arrhythmias Cardiac Associate 35773684
Breast Neoplasms Associate 24434436
Cardiomyopathies Associate 35773684
Cardiomyopathy Hypertrophic Associate 35773684
Dementia Associate 30120299
Disease Associate 35773684
Dissection Blood Vessel Associate 22617347
Immunoglobulin G4 Related Disease Associate 35773684
Immunologic Deficiency Syndromes Stimulate 35773684