Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6637
Gene name Gene Name - the full gene name approved by the HGNC.	Small nuclear ribonucleoprotein polypeptide G
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SNRPG
Synonyms (NCBI Gene) Gene synonyms aliases	SMG, Sm-G
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participate

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044593	hsa-miR-320a	CLASH	23622248
MIRT1376273	hsa-miR-185	CLIP-seq
MIRT1376274	hsa-miR-4306	CLIP-seq
MIRT1376275	hsa-miR-4644	CLIP-seq
MIRT1376276	hsa-miR-4735-5p	CLIP-seq
MIRT1376277	hsa-miR-4768-5p	CLIP-seq
MIRT1376278	hsa-miR-4775	CLIP-seq
MIRT1376279	hsa-miR-4802-5p	CLIP-seq
MIRT1376280	hsa-miR-499-3p	CLIP-seq
MIRT1376281	hsa-miR-499a-3p	CLIP-seq
MIRT1376282	hsa-miR-590-3p	CLIP-seq
MIRT1376283	hsa-miR-629	CLIP-seq
MIRT1376273	hsa-miR-185	CLIP-seq
MIRT1376274	hsa-miR-4306	CLIP-seq
MIRT1376275	hsa-miR-4644	CLIP-seq
MIRT1376277	hsa-miR-4768-5p	CLIP-seq
MIRT1376279	hsa-miR-4802-5p	CLIP-seq
MIRT1376283	hsa-miR-629	CLIP-seq
MIRT1376277	hsa-miR-4768-5p	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000245	Process	Spliceosomal complex assembly	NAS	7744013
GO:0000387	Process	Spliceosomal snRNP assembly	IDA	18984161
GO:0000387	Process	Spliceosomal snRNP assembly	TAS
GO:0000398	Process	MRNA splicing, via spliceosome	IBA	21873635
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0000398	Process	MRNA splicing, via spliceosome	IDA	28076346
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9417867, 12165861, 14603251, 16189514, 18984161, 25416956, 30021884, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	28076346
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	TAS	7744013
GO:0005682	Component	U5 snRNP	IBA	21873635
GO:0005683	Component	U7 snRNP	IDA	11574479
GO:0005685	Component	U1 snRNP	IBA	21873635
GO:0005685	Component	U1 snRNP	IDA	21113136, 25555158
GO:0005686	Component	U2 snRNP	IBA	21873635
GO:0005687	Component	U4 snRNP	IBA	21873635
GO:0005687	Component	U4 snRNP	IDA	21516107
GO:0005689	Component	U12-type spliceosomal complex	IBA	21873635
GO:0005689	Component	U12-type spliceosomal complex	IDA	15146077
GO:0005829	Component	Cytosol	IDA	18984161
GO:0005829	Component	Cytosol	TAS
GO:0006369	Process	Termination of RNA polymerase II transcription	TAS
GO:0008334	Process	Histone mRNA metabolic process	TAS
GO:0008380	Process	RNA splicing	TAS	7744013
GO:0030532	Component	Small nuclear ribonucleoprotein complex	NAS	7744013
GO:0034709	Component	Methylosome	IDA	18984161
GO:0034719	Component	SMN-Sm protein complex	IBA	21873635
GO:0034719	Component	SMN-Sm protein complex	IDA	18984161
GO:0043186	Component	P granule	IBA	21873635
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IDA	26912367
GO:0051170	Process	Import into nucleus	TAS
GO:0071004	Component	U2-type prespliceosome	IBA	21873635
GO:0071005	Component	U2-type precatalytic spliceosome	IDA	28781166
GO:0071007	Component	U2-type catalytic step 2 spliceosome	IDA	28076346
GO:0071011	Component	Precatalytic spliceosome	IBA	21873635
GO:0071013	Component	Catalytic step 2 spliceosome	IBA	21873635
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:0097526	Component	Spliceosomal tri-snRNP complex	IBA	21873635
GO:1990904	Component	Ribonucleoprotein complex	IBA	21873635

MIM	HGNC	e!Ensembl
603542	11163	ENSG00000143977

Protein

UniProt ID

P62308

Protein name

Small nuclear ribonucleoprotein G (snRNP-G) (Sm protein G) (Sm-G) (SmG)

Protein function

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:23333303, Pu

PDB

3CW1 , 3JCR , 3PGW , 4F7U , 4PJO , 4V98 , 4WZJ , 5MQF , 5O9Z , 5XJC , 5XJL , 5XJQ , 5XJR , 5XJT , 5XJU , 5YZG , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6AHD , 6FF7 , 6ICZ , 6ID0 , 6ID1 , 6QDV , 6QW6 , 6QX9 , 6V4X , 6Y53 , 6Y5Q , 7A5P , 7ABG , 7ABI , 7B0Y , 7DVQ , 7EVO , 7QTT , 7VPX , 7W59 , 7W5A , 7W5B , 8C6J , 8CH6 , 8H6E , 8H6J , 8H6K , 8H6L , 8HK1 , 8I0P , 8I0R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01423	LSM	7 → 72	LSM domain	Domain

Sequence

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Spliceosome		SLBP independent Processing of Histone Pre-mRNAs snRNP Assembly mRNA Splicing - Major Pathway mRNA Splicing - Minor Pathway RNA Polymerase II Transcription Termination SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	27602772

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	34225819, 34461609, 36405716
Alzheimer Disease	Inhibit	36195955
Cognitive Dysfunction	Associate	34461609

SNRPG (small nuclear ribonucleoprotein polypeptide G)