Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	662
Gene name	BCL2 interacting protein 1
Gene symbol	BNIP1
Synonyms (NCBI Gene)	NIP1SEC20TRG-8
Chromosome	5
Chromosome location	5q35.1
Summary	This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735792	hsa-miR-20a-5p	qRT-PCR	32864858

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005484	Function	SNAP receptor activity	IDA	15272311
GO:0005484	Function	SNAP receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	7954800, 15272311, 21931693, 23896122, 32296183
GO:0005635	Component	Nuclear envelope	IDA	7954800
GO:0005737	Component	Cytoplasm	IDA	7954800
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	23896122
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	15272311
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	23896122
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	15272311
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IPI	7954800
GO:0007029	Process	Endoplasmic reticulum organization	IMP	15272311
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016320	Process	Endoplasmic reticulum membrane fusion	IMP	15272311
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0030137	Component	COPI-coated vesicle	IEA
GO:0031201	Component	SNARE complex	IBA
GO:0031201	Component	SNARE complex	IDA	15272311
GO:0031201	Component	SNARE complex	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	21931693, 23896122
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7954800
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	7954800
GO:0048763	Function	Calcium-induced calcium release activity	IDA	29222049
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097194	Process	Execution phase of apoptosis	IC	15272311
GO:0140208	Process	Apoptotic process in response to mitochondrial fragmentation	IDA	29222049

MIM	HGNC	e!Ensembl
603291	1082	ENSG00000113734

Q12981

Protein name

Vesicle transport protein SEC20 (BCL2/adenovirus E1B 19 kDa protein-interacting protein 1) (Transformation-related gene 8 protein) (TRG-8)

Protein function

As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization (PubMed:15272311). Also plays a role in apoptosis (PubMed:15272311, PubMed:23896122, P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03908	Sec20	133 → 224	Sec20	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine. {ECO:0000269|PubMed:1021740

Sequence

MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQD
LEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDL
LRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSM
SGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL

Sequence length

228

Interactions

View interactions

	KEGG		Reactome
	SNARE interactions in vesicular transport		COPI-dependent Golgi-to-ER retrograde traffic

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Spondyloepiphyseal dysplasia congenita	Uncertain significance	rs2113831423	RCV001638059
SPONDYLOEPIPHYSEAL DYSPLASIA, HOLLING TYPE	Uncertain significance	rs2113831423	RCV005642506

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute On Chronic Liver Failure	Associate	26173605
Adenocarcinoma	Associate	34252349
Amyotrophic Lateral Sclerosis	Associate	29630712
Down Syndrome	Associate	15716609
Hypertension	Associate	19237446
Lymphatic Metastasis	Inhibit	30840260
Melanoma	Associate	19383853
Uterine Cervical Neoplasms	Associate	30840260

BNIP1 (BCL2 interacting protein 1)