BNIP1 (BCL2 interacting protein 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
662
Gene name Gene Name - the full gene name approved by the HGNC.
BCL2 interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BNIP1
Synonyms (NCBI Gene) Gene synonyms aliases
NIP1, SEC20, TRG-8
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT735792 hsa-miR-20a-5p qRT-PCR 32864858
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(25)
GO ID Ontology Definition Evidence Reference
GO:0005484 Function SNAP receptor activity IDA 15272311
GO:0005515 Function Protein binding IPI 7954800, 15272311, 21931693, 23896122, 32296183
GO:0005635 Component Nuclear envelope IDA 7954800
GO:0005737 Component Cytoplasm IDA 7954800
GO:0005783 Component Endoplasmic reticulum IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603291 1082 ENSG00000113734
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q12981
Protein name Vesicle transport protein SEC20 (BCL2/adenovirus E1B 19 kDa protein-interacting protein 1) (Transformation-related gene 8 protein) (TRG-8)
Protein function As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization (PubMed:15272311). Also plays a role in apoptosis (PubMed:15272311, PubMed:23896122, P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03908 Sec20 133 → 224 Sec20 Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine. {ECO:0000269|PubMed:1021740
Sequence 
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQD
LEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDL
LRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSM
SGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
Sequence length 228
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  SNARE interactions in vesicular transport   COPI-dependent Golgi-to-ER retrograde traffic
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Glaucoma Glaucoma, Open-Angle rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328
View all (29 more)		 29891935
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Acute On Chronic Liver Failure Associate 26173605
Adenocarcinoma Associate 34252349
Amyotrophic Lateral Sclerosis Associate 29630712
Down Syndrome Associate 15716609
Hypertension Associate 19237446
Lymphatic Metastasis Inhibit 30840260
Melanoma Associate 19383853
Uterine Cervical Neoplasms Associate 30840260