Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65991
Gene name Gene Name - the full gene name approved by the HGNC.
FUN14 domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FUNDC2
Synonyms (NCBI Gene) Gene synonyms aliases
DC44, HCBP6, HCC3, PD03104
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003098 hsa-miR-122-5p Luciferase reporter assay, qRT-PCR 19296470
MIRT003098 hsa-miR-122-5p Luciferase reporter assay, qRT-PCR 19296470
MIRT044913 hsa-miR-186-5p CLASH 23622248
MIRT042745 hsa-miR-339-5p CLASH 23622248
MIRT041249 hsa-miR-193b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000422 Process Autophagy of mitochondrion IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus HDA 21630459
GO:0005739 Component Mitochondrion HDA 20833797
GO:0005739 Component Mitochondrion IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
301042 24925 ENSG00000165775
Protein
UniProt ID Q9BWH2
Protein name FUN14 domain-containing protein 2 (Cervical cancer proto-oncogene 3 protein) (HCC-3) (Hepatitis C virus core-binding protein 6)
Protein function Binds directly and specifically 1,2-Diacyl-sn-glycero-3-phospho-(1'-myo-inositol-3',4',5'-bisphosphate) (PIP3) leading to the recruitment of PIP3 to mitochondria and may play a role in the regulation of the platelet activation via AKT/GSK3B/cGMP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04930 FUN14 87 187 FUN14 family Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in platelets (at protein level). {ECO:0000269|PubMed:30576423}.
Sequence
METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFA
KKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQ
LANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFF
GGFLLGM
AS
Sequence length 189
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Ischemic stroke Ischemic stroke 26908601 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Coronary Artery Disease Associate 26908601
Hypoxia Associate 34105393
Hypoxia Brain Associate 34105393
Mitochondrial Diseases Associate 34105393
Nerve Degeneration Associate 34105393
Thrombosis Associate 26908601