STK33 (serine/threonine kinase 33)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65975
Gene name Gene Name - the full gene name approved by the HGNC.
Serine/threonine kinase 33
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STK33
Synonyms (NCBI Gene) Gene synonyms aliases
SPGF93
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SPGF93
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs1057520013 A>C Likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
miRTarBase ID miRNA Experiments Reference
MIRT025022 hsa-miR-183-5p Sequencing 20371350
MIRT027202 hsa-miR-103a-3p Sequencing 20371350
MIRT032007 hsa-miR-16-5p Sequencing 20371350
MIRT047404 hsa-miR-10b-5p CLASH 23622248
MIRT037139 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0004674 Function Protein serine/threonine kinase activity IBA 21873635
GO:0004674 Function Protein serine/threonine kinase activity ISS
GO:0005524 Function ATP binding IEA
GO:0005634 Component Nucleus IBA 21873635
GO:0005737 Component Cytoplasm IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607670 14568 ENSG00000130413
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9BYT3
Protein name Serine/threonine-protein kinase 33 (EC 2.7.11.1)
Protein function Serine/threonine protein kinase required for spermatid differentiation and male fertility (PubMed:37146716, PubMed:38781365). Promotes sperm flagella assembly during spermatogenesis by mediating phosphorylation of fibrous sheath proteins AKAP3 a
PDB 8VF6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 116 → 381 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis, fetal lung and heart, followed by pituitary gland, kidney, interventricular septum, pancreas, heart, trachea, thyroid gland and uterus. Weak hybridization signals were observed in the following tissues: amyg
Sequence 
MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERK
KEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGR
ILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQ
VFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLK
LENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDY
SQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSISDCAKSVLKQ
LMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS
TEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAE
IKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL
Sequence length 514
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Small cell carcinoma of lung, Large cell carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 28604730
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Restless Legs Syndrome Restless Legs Syndrome GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Moyamoya Disease Moyamoya Disease GWAS
Show/Hide Text Mining Associations (14)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32769881
Burkitt Lymphoma Associate 26325594
Carcinogenesis Stimulate 25603720
Colorectal Neoplasms Associate 24393480
Glioblastoma Associate 37277696
Head and Neck Neoplasms Associate 31131446
Idiopathic Pulmonary Fibrosis Stimulate 35130915
Lung Neoplasms Associate 25662617
Multiple Myeloma Associate 35328342
Neoplasms Associate 22323609, 22451720, 23967198, 25662617, 37277696, 40095483