Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	65975
Gene name Gene Name - the full gene name approved by the HGNC.	Serine/threonine kinase 33
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	STK33
Synonyms (NCBI Gene) Gene synonyms aliases	SPGF93
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.4

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520013	A>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025022	hsa-miR-183-5p	Sequencing	20371350
MIRT027202	hsa-miR-103a-3p	Sequencing	20371350
MIRT032007	hsa-miR-16-5p	Sequencing	20371350
MIRT047404	hsa-miR-10b-5p	CLASH	23622248
MIRT037139	hsa-miR-877-3p	CLASH	23622248
MIRT1397712	hsa-miR-2054	CLIP-seq
MIRT1397713	hsa-miR-219-1-3p	CLIP-seq
MIRT1397714	hsa-miR-3177-5p	CLIP-seq
MIRT1397715	hsa-miR-3692	CLIP-seq
MIRT1397716	hsa-miR-4436b-5p	CLIP-seq
MIRT1397717	hsa-miR-4718	CLIP-seq
MIRT1397718	hsa-miR-526b	CLIP-seq
MIRT1397719	hsa-miR-571	CLIP-seq
MIRT2635388	hsa-miR-183	CLIP-seq
MIRT1397712	hsa-miR-2054	CLIP-seq
MIRT2635389	hsa-miR-31	CLIP-seq
MIRT2635390	hsa-miR-4263	CLIP-seq
MIRT1397717	hsa-miR-4718	CLIP-seq
MIRT2635391	hsa-miR-4775	CLIP-seq
MIRT2635392	hsa-miR-576-5p	CLIP-seq
MIRT2635393	hsa-miR-590-3p	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002177	Component	Manchette	IEA
GO:0002177	Component	Manchette	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	37146716
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IMP	37146716
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0044773	Process	Mitotic DNA damage checkpoint signaling	IBA
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1905198	Process	Manchette assembly	IEA
GO:1905198	Process	Manchette assembly	ISS

MIM	HGNC	e!Ensembl
607670	14568	ENSG00000130413

Protein

UniProt ID

Q9BYT3

Protein name

Serine/threonine-protein kinase 33 (EC 2.7.11.1)

Protein function

Serine/threonine protein kinase required for spermatid differentiation and male fertility (PubMed:37146716, PubMed:38781365). Promotes sperm flagella assembly during spermatogenesis by mediating phosphorylation of fibrous sheath proteins AKAP3 a

PDB

8VF6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	116 → 381	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis, fetal lung and heart, followed by pituitary gland, kidney, interventricular septum, pancreas, heart, trachea, thyroid gland and uterus. Weak hybridization signals were observed in the following tissues: amyg

Sequence

MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERK
KEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGR
ILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQ
VFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLK
LENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDY
SQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSISDCAKSVLKQ
LMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS
TEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAE
IKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL

Sequence length

514

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Moyamoya Disease	Moyamoya disease	N/A	N/A	GWAS
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	32769881
Burkitt Lymphoma	Associate	26325594
Carcinogenesis	Stimulate	25603720
Colorectal Neoplasms	Associate	24393480
Glioblastoma	Associate	37277696
Head and Neck Neoplasms	Associate	31131446
Idiopathic Pulmonary Fibrosis	Stimulate	35130915
Lung Neoplasms	Associate	25662617
Multiple Myeloma	Associate	35328342
Neoplasms	Associate	22323609, 22451720, 23967198, 25662617, 37277696, 40095483
Obesity	Associate	23967198
Pancreatic Neoplasms	Associate	20581473
Small Cell Lung Carcinoma	Associate	25662617
Squamous Cell Carcinoma of Head and Neck	Associate	25603720

STK33 (serine/threonine kinase 33)