SLC18A1 (solute carrier family 18 member A1)

Gene

• Entrez ID: 6570
• Gene name: Solute carrier family 18 member A1
• Gene symbol: SLC18A1
• Synonyms (NCBI Gene): CGAT, VAT1, VMAT1
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2104638	hsa-miR-4778-3p	CLIP-seq
MIRT2329112	hsa-miR-3153	CLIP-seq
MIRT2329113	hsa-miR-4505	CLIP-seq
MIRT2329114	hsa-miR-4638-5p	CLIP-seq
MIRT2329115	hsa-miR-4646-5p	CLIP-seq
MIRT2329116	hsa-miR-4668-5p	CLIP-seq
MIRT2329117	hsa-miR-513c	CLIP-seq
MIRT2329118	hsa-miR-514b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005335	Function	Serotonin:sodium:chloride symporter activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	16326835
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006837	Process	Serotonin transport	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	TAS	8643547
GO:0015311	Function	Monoamine:proton antiporter activity	IDA	8643547, 16326835, 23337945
GO:0015311	Function	Monoamine:proton antiporter activity	IEA
GO:0015842	Process	Aminergic neurotransmitter loading into synaptic vesicle	IBA
GO:0015844	Process	Monoamine transport	TAS	8643547
GO:0015872	Process	Dopamine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IDA	16326835
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0043195	Component	Terminal bouton	IBA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	IEA
GO:0051610	Process	Serotonin uptake	IDA	8643547, 16326835, 23337945
GO:0051610	Process	Serotonin uptake	IEA
GO:0051620	Process	Norepinephrine uptake	IDA	23337945
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070083	Component	Clathrin-sculpted monoamine transport vesicle membrane	IEA
GO:0070083	Component	Clathrin-sculpted monoamine transport vesicle membrane	TAS
GO:0090494	Process	Dopamine uptake	IDA	23337945
GO:0098793	Component	Presynapse	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 193002
• HGNC: 10934
• e!Ensembl: ENSG00000036565

Protein

• UniProt ID: P54219
• Protein name: Chromaffin granule amine transporter (Solute carrier family 18 member 1) (Vesicular amine transporter 1) (VAT1)
• Protein function: [Isoform 1]: Electrogenic antiporter that exchanges one cationic monoamine with two intravesicular protons across the membrane of secretory and synaptic vesicles. Uses the electrochemical proton gradient established by the V-type proton-pump ATP
• PDB: 8TGG, 8TGH, 8TGI, 8TGJ, 8TGK, 8TGL, 8TGM, 8TGN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	96 → 433	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed primarily in neuroendocrine tissues. Highly expressed in chromaffin cells of the adrenal medulla (at protein level). Detected in peripheral sympathetic ganglia (at protein level). Found in some paracrine cells in stomach and
• Sequence:

  MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
  LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
  HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
  TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
  LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
  YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
  NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
  RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
  PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE

• Sequence length: 525

Pathways

KEGG:

Synaptic vesicle cycle
Serotonergic synapse
Dopaminergic synapse
Parkinson disease
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

Na+/Cl- dependent neurotransmitter transporters

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	30194079
Alcoholism	Associate	26861143
Anxiety	Associate	26861143
Anxiety Disorders	Associate	26861143
Autistic Disorder	Associate	30194079
Bipolar Disorder	Associate	16936705, 26861143, 30194079
Carcinoid Tumor	Associate	17717663
Carcinoid Tumor	Stimulate	18708724
Complement component 5 deficiency	Associate	30194079
Depressive Disorder	Associate	26861143
Disruptive Impulse Control and Conduct Disorders	Associate	26861143
Glucagonoma	Associate	18708724
Ileal Diseases	Associate	18708724
Lung Neoplasms	Associate	30194079
Mental Disorders	Associate	26861143
Multiple Endocrine Neoplasia Type 2a	Associate	16189177
Muscular Dystrophy Congenital Producing Arthrogryposis	Associate	16189177
Neoplasms	Inhibit	18708724, 26338179
Neoplasms	Associate	30194079
Neuroblastoma	Associate	26338179, 37541765
Ovarian Neoplasms	Associate	29170526
Paraganglioma	Associate	35524772
Pheochromocytoma	Associate	35524772
Schizophrenia	Associate	16936705, 30194079