Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6570
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 18 member A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC18A1
Synonyms (NCBI Gene) Gene synonyms aliases	CGAT, VAT1, VMAT1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments
MIRT2104638	hsa-miR-4778-3p	CLIP-seq
MIRT2329112	hsa-miR-3153	CLIP-seq
MIRT2329113	hsa-miR-4505	CLIP-seq
MIRT2329114	hsa-miR-4638-5p	CLIP-seq
MIRT2329115	hsa-miR-4646-5p	CLIP-seq
MIRT2329116	hsa-miR-4668-5p	CLIP-seq
MIRT2329117	hsa-miR-513c	CLIP-seq
MIRT2329118	hsa-miR-514b-5p	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005335	Function	Serotonin:sodium symporter activity	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	TAS	8643547
GO:0015842	Process	Aminergic neurotransmitter loading into synaptic vesicle	IBA	21873635
GO:0015844	Process	Monoamine transport	TAS	8643547
GO:0016021	Component	Integral component of membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA	21873635
GO:0030672	Component	Synaptic vesicle membrane	IBA	21873635
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0043195	Component	Terminal bouton	IBA	21873635
GO:0051610	Process	Serotonin uptake	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070083	Component	Clathrin-sculpted monoamine transport vesicle membrane	TAS

MIM	HGNC	e!Ensembl
193002	10934	ENSG00000036565

Protein

UniProt ID

P54219

Protein name

Chromaffin granule amine transporter (Solute carrier family 18 member 1) (Vesicular amine transporter 1) (VAT1)

Protein function

[Isoform 1]: Electrogenic antiporter that exchanges one cationic monoamine with two intravesicular protons across the membrane of secretory and synaptic vesicles. Uses the electrochemical proton gradient established by the V-type proton-pump ATP

PDB

8TGG , 8TGH , 8TGI , 8TGJ , 8TGK , 8TGL , 8TGM , 8TGN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	96 → 433	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in neuroendocrine tissues. Highly expressed in chromaffin cells of the adrenal medulla (at protein level). Detected in peripheral sympathetic ganglia (at protein level). Found in some paracrine cells in stomach and

Sequence

MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE

Sequence length

525

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Serotonergic synapse Dopaminergic synapse Parkinson disease Cocaine addiction Amphetamine addiction Alcoholism		Na+/Cl- dependent neurotransmitter transporters

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	18451639

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder	19204725	ClinVar
Metabolic Syndrome	Metabolic Syndrome		GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	30194079
Alcoholism	Associate	26861143
Anxiety	Associate	26861143
Anxiety Disorders	Associate	26861143
Autistic Disorder	Associate	30194079
Bipolar Disorder	Associate	16936705, 26861143, 30194079
Carcinoid Tumor	Associate	17717663
Carcinoid Tumor	Stimulate	18708724
Complement component 5 deficiency	Associate	30194079
Depressive Disorder	Associate	26861143
Disruptive Impulse Control and Conduct Disorders	Associate	26861143
Glucagonoma	Associate	18708724
Ileal Diseases	Associate	18708724
Lung Neoplasms	Associate	30194079
Mental Disorders	Associate	26861143
Multiple Endocrine Neoplasia Type 2a	Associate	16189177
Muscular Dystrophy Congenital Producing Arthrogryposis	Associate	16189177
Neoplasms	Inhibit	18708724, 26338179
Neoplasms	Associate	30194079
Neuroblastoma	Associate	26338179, 37541765
Ovarian Neoplasms	Associate	29170526
Paraganglioma	Associate	35524772
Pheochromocytoma	Associate	35524772
Schizophrenia	Associate	16936705, 30194079

SLC18A1 (solute carrier family 18 member A1)