Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6565
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 15 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC15A2
Synonyms (NCBI Gene) Gene synonyms aliases	PEPT2
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The mammalian kidney expresses a proton-coupled peptide transporter that is responsible for the absorption of small peptides, as well as beta-lactam antibiotics and other peptide-like drugs, from the tubular filtrate. This transporter, SLC15A2, belongs to

Show/Hide all(196)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023364	hsa-miR-122-5p	Microarray	17612493
MIRT631111	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631110	hsa-miR-764	HITS-CLIP	23824327
MIRT631109	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631108	hsa-miR-4421	HITS-CLIP	23824327
MIRT631107	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT631106	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT643111	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT643110	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT643109	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631105	hsa-miR-640	HITS-CLIP	23824327
MIRT631111	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631110	hsa-miR-764	HITS-CLIP	23824327
MIRT631109	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631108	hsa-miR-4421	HITS-CLIP	23824327
MIRT631107	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT631106	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT631105	hsa-miR-640	HITS-CLIP	23824327
MIRT631111	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631110	hsa-miR-764	HITS-CLIP	23824327
MIRT631109	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631108	hsa-miR-4421	HITS-CLIP	23824327
MIRT631107	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT631106	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT643111	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT643110	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT643109	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631105	hsa-miR-640	HITS-CLIP	23824327
MIRT631111	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631110	hsa-miR-764	HITS-CLIP	23824327
MIRT631109	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631108	hsa-miR-4421	HITS-CLIP	23824327
MIRT631107	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT631106	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT631105	hsa-miR-640	HITS-CLIP	23824327
MIRT1352679	hsa-miR-197	CLIP-seq
MIRT1352680	hsa-miR-3145-3p	CLIP-seq
MIRT1352681	hsa-miR-3170	CLIP-seq
MIRT1352682	hsa-miR-3187-3p	CLIP-seq
MIRT1352683	hsa-miR-3613-3p	CLIP-seq
MIRT1352684	hsa-miR-3647-3p	CLIP-seq
MIRT1352685	hsa-miR-3655	CLIP-seq
MIRT1352686	hsa-miR-3663-5p	CLIP-seq
MIRT1352687	hsa-miR-3714	CLIP-seq
MIRT1352688	hsa-miR-3918	CLIP-seq
MIRT1352689	hsa-miR-3922-5p	CLIP-seq
MIRT1352690	hsa-miR-3934	CLIP-seq
MIRT1352691	hsa-miR-3977	CLIP-seq
MIRT1352692	hsa-miR-4282	CLIP-seq
MIRT1352693	hsa-miR-4435	CLIP-seq
MIRT1352694	hsa-miR-4640-5p	CLIP-seq
MIRT1352695	hsa-miR-4701-5p	CLIP-seq
MIRT1352696	hsa-miR-4712-5p	CLIP-seq
MIRT1352697	hsa-miR-4716-5p	CLIP-seq
MIRT1352698	hsa-miR-4726-5p	CLIP-seq
MIRT1352699	hsa-miR-4755-3p	CLIP-seq
MIRT1352700	hsa-miR-4781-3p	CLIP-seq
MIRT1352701	hsa-miR-5096	CLIP-seq
MIRT1352702	hsa-miR-513a-3p	CLIP-seq
MIRT1352703	hsa-miR-522	CLIP-seq
MIRT1352704	hsa-miR-548s	CLIP-seq
MIRT1352705	hsa-miR-588	CLIP-seq
MIRT1352706	hsa-miR-606	CLIP-seq
MIRT1352707	hsa-miR-615-5p	CLIP-seq
MIRT1352708	hsa-miR-645	CLIP-seq
MIRT1352709	hsa-miR-770-5p	CLIP-seq
MIRT1352710	hsa-miR-936	CLIP-seq
MIRT1352711	hsa-miR-1910	CLIP-seq
MIRT1352679	hsa-miR-197	CLIP-seq
MIRT1352712	hsa-miR-3148	CLIP-seq
MIRT1352713	hsa-miR-3163	CLIP-seq
MIRT1352714	hsa-miR-3182	CLIP-seq
MIRT1352682	hsa-miR-3187-3p	CLIP-seq
MIRT1352715	hsa-miR-340	CLIP-seq
MIRT1352686	hsa-miR-3663-5p	CLIP-seq
MIRT1352716	hsa-miR-3690	CLIP-seq
MIRT1352687	hsa-miR-3714	CLIP-seq
MIRT1352689	hsa-miR-3922-5p	CLIP-seq
MIRT1352690	hsa-miR-3934	CLIP-seq
MIRT1352717	hsa-miR-409-3p	CLIP-seq
MIRT1352718	hsa-miR-411	CLIP-seq
MIRT1352719	hsa-miR-4254	CLIP-seq
MIRT1352720	hsa-miR-4307	CLIP-seq
MIRT1352721	hsa-miR-4317	CLIP-seq
MIRT1352722	hsa-miR-433	CLIP-seq
MIRT1352693	hsa-miR-4435	CLIP-seq
MIRT1352723	hsa-miR-4462	CLIP-seq
MIRT1352724	hsa-miR-4532	CLIP-seq
MIRT1352695	hsa-miR-4701-5p	CLIP-seq
MIRT1352697	hsa-miR-4716-5p	CLIP-seq
MIRT1352699	hsa-miR-4755-3p	CLIP-seq
MIRT1352700	hsa-miR-4781-3p	CLIP-seq
MIRT1352725	hsa-miR-498	CLIP-seq
MIRT1352701	hsa-miR-5096	CLIP-seq
MIRT1352702	hsa-miR-513a-3p	CLIP-seq
MIRT1352703	hsa-miR-522	CLIP-seq
MIRT1352726	hsa-miR-548aa	CLIP-seq
MIRT1352704	hsa-miR-548s	CLIP-seq
MIRT1352727	hsa-miR-580	CLIP-seq
MIRT1352705	hsa-miR-588	CLIP-seq
MIRT1352728	hsa-miR-591	CLIP-seq
MIRT1352708	hsa-miR-645	CLIP-seq
MIRT2104421	hsa-miR-105	CLIP-seq
MIRT2104422	hsa-miR-106a	CLIP-seq
MIRT2104423	hsa-miR-106b	CLIP-seq
MIRT2104424	hsa-miR-1228	CLIP-seq
MIRT2104425	hsa-miR-1305	CLIP-seq
MIRT2104426	hsa-miR-150	CLIP-seq
MIRT2104427	hsa-miR-17	CLIP-seq
MIRT1352679	hsa-miR-197	CLIP-seq
MIRT2104428	hsa-miR-20a	CLIP-seq
MIRT2104429	hsa-miR-20b	CLIP-seq
MIRT2104430	hsa-miR-2276	CLIP-seq
MIRT2104431	hsa-miR-302a	CLIP-seq
MIRT2104432	hsa-miR-302b	CLIP-seq
MIRT2104433	hsa-miR-302c	CLIP-seq
MIRT2104434	hsa-miR-302d	CLIP-seq
MIRT2104435	hsa-miR-302e	CLIP-seq
MIRT1352682	hsa-miR-3187-3p	CLIP-seq
MIRT2104436	hsa-miR-361-3p	CLIP-seq
MIRT2104437	hsa-miR-3646	CLIP-seq
MIRT1352686	hsa-miR-3663-5p	CLIP-seq
MIRT2104438	hsa-miR-3671	CLIP-seq
MIRT2104439	hsa-miR-372	CLIP-seq
MIRT2104440	hsa-miR-373	CLIP-seq
MIRT1352690	hsa-miR-3934	CLIP-seq
MIRT1352693	hsa-miR-4435	CLIP-seq
MIRT2104441	hsa-miR-4438	CLIP-seq
MIRT2104442	hsa-miR-4639-3p	CLIP-seq
MIRT1352695	hsa-miR-4701-5p	CLIP-seq
MIRT1352697	hsa-miR-4716-5p	CLIP-seq
MIRT2104443	hsa-miR-4731-5p	CLIP-seq
MIRT2104444	hsa-miR-4735-5p	CLIP-seq
MIRT1352699	hsa-miR-4755-3p	CLIP-seq
MIRT2104445	hsa-miR-4760-5p	CLIP-seq
MIRT2104446	hsa-miR-4769-3p	CLIP-seq
MIRT2104447	hsa-miR-4772-3p	CLIP-seq
MIRT2104448	hsa-miR-4775	CLIP-seq
MIRT2104449	hsa-miR-4778-5p	CLIP-seq
MIRT1352700	hsa-miR-4781-3p	CLIP-seq
MIRT2104450	hsa-miR-4794	CLIP-seq
MIRT1352701	hsa-miR-5096	CLIP-seq
MIRT2104451	hsa-miR-512-3p	CLIP-seq
MIRT2104452	hsa-miR-519d	CLIP-seq
MIRT2104453	hsa-miR-520a-3p	CLIP-seq
MIRT2104454	hsa-miR-520b	CLIP-seq
MIRT2104455	hsa-miR-520c-3p	CLIP-seq
MIRT2104456	hsa-miR-520d-3p	CLIP-seq
MIRT2104457	hsa-miR-520e	CLIP-seq
MIRT2104458	hsa-miR-520g	CLIP-seq
MIRT2104459	hsa-miR-520h	CLIP-seq
MIRT2104460	hsa-miR-544	CLIP-seq
MIRT1352704	hsa-miR-548s	CLIP-seq
MIRT1352705	hsa-miR-588	CLIP-seq
MIRT2104461	hsa-miR-590-3p	CLIP-seq
MIRT2104462	hsa-miR-593	CLIP-seq
MIRT2104463	hsa-miR-607	CLIP-seq
MIRT2104464	hsa-miR-93	CLIP-seq
MIRT2328852	hsa-miR-1307	CLIP-seq
MIRT1352721	hsa-miR-4317	CLIP-seq
MIRT2104441	hsa-miR-4438	CLIP-seq
MIRT1352724	hsa-miR-4532	CLIP-seq
MIRT2328853	hsa-miR-4638-5p	CLIP-seq
MIRT2328854	hsa-miR-4695-3p	CLIP-seq
MIRT2328855	hsa-miR-5095	CLIP-seq
MIRT1352714	hsa-miR-3182	CLIP-seq
MIRT2328856	hsa-miR-4659a-3p	CLIP-seq
MIRT2328857	hsa-miR-4659b-3p	CLIP-seq
MIRT2459494	hsa-miR-3157-5p	CLIP-seq
MIRT1352714	hsa-miR-3182	CLIP-seq
MIRT1352691	hsa-miR-3977	CLIP-seq
MIRT1352724	hsa-miR-4532	CLIP-seq
MIRT2328856	hsa-miR-4659a-3p	CLIP-seq
MIRT2328857	hsa-miR-4659b-3p	CLIP-seq
MIRT2459495	hsa-miR-4740-3p	CLIP-seq
MIRT1352725	hsa-miR-498	CLIP-seq
MIRT2104424	hsa-miR-1228	CLIP-seq
MIRT2623252	hsa-miR-3619-3p	CLIP-seq
MIRT2623253	hsa-miR-4722-3p	CLIP-seq
MIRT2104444	hsa-miR-4735-5p	CLIP-seq
MIRT2104446	hsa-miR-4769-3p	CLIP-seq
MIRT2104448	hsa-miR-4775	CLIP-seq
MIRT2623254	hsa-miR-4776-5p	CLIP-seq
MIRT2104450	hsa-miR-4794	CLIP-seq
MIRT2623255	hsa-miR-485-3p	CLIP-seq
MIRT2623256	hsa-miR-487a	CLIP-seq
MIRT2104461	hsa-miR-590-3p	CLIP-seq
MIRT2104424	hsa-miR-1228	CLIP-seq
MIRT2623252	hsa-miR-3619-3p	CLIP-seq
MIRT2104444	hsa-miR-4735-5p	CLIP-seq
MIRT2104448	hsa-miR-4775	CLIP-seq
MIRT2623254	hsa-miR-4776-5p	CLIP-seq
MIRT2104450	hsa-miR-4794	CLIP-seq
MIRT2623255	hsa-miR-485-3p	CLIP-seq
MIRT2623256	hsa-miR-487a	CLIP-seq
MIRT2104461	hsa-miR-590-3p	CLIP-seq

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16738539, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	7756356, 18367661, 18762712
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	7756356
GO:0006857	Process	Oligopeptide transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015333	Function	Peptide:proton symporter activity	IDA	7756356, 18367661, 31073693
GO:0015333	Function	Peptide:proton symporter activity	IEA
GO:0015333	Function	Peptide:proton symporter activity	TAS	7756356
GO:0015833	Process	Peptide transport	IEA
GO:0015835	Process	Peptidoglycan transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	RCA	7756356
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IDA	20406817
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035673	Function	Oligopeptide transmembrane transporter activity	IEA
GO:0042908	Process	Xenobiotic transport	ISS
GO:0042937	Function	Tripeptide transmembrane transporter activity	ISS
GO:0042938	Process	Dipeptide transport	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708
GO:0070293	Process	Renal absorption	ISS
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	ISS
GO:0071916	Function	Dipeptide transmembrane transporter activity	IBA
GO:0071916	Function	Dipeptide transmembrane transporter activity	IDA	7756356, 18367661, 18762712, 31073693
GO:0071916	Function	Dipeptide transmembrane transporter activity	IEA
GO:0140206	Process	Dipeptide import across plasma membrane	IBA
GO:0140206	Process	Dipeptide import across plasma membrane	IDA	7756356, 18367661, 18762712, 31073693
GO:0140206	Process	Dipeptide import across plasma membrane	IEA
GO:0140207	Process	Tripeptide import across plasma membrane	ISS
GO:0140367	Process	Antibacterial innate immune response	IDA	20406817
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	NAS	16738539

MIM	HGNC	e!Ensembl
602339	10921	ENSG00000163406

Protein

UniProt ID

Q16348

Protein name

Solute carrier family 15 member 2 (Kidney H(+)/peptide cotransporter) (Oligopeptide transporter, kidney isoform) (Peptide transporter 2)

Protein function

Proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides (PubMed:16434549, PubMed:18367661, PubMed:7756356). Transports neutral and anionic dipeptides with a proton to peptide sto

PDB

6EZI , 7PMY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00854	PTR2	111 → 487	POT family	Family
PF00854	PTR2	566 → 675	POT family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney (PubMed:7756356). Not detected in intestine (PubMed:7756356). Highly expressed in macrophages (PubMed:20406817). {ECO:0000269|PubMed:20406817, ECO:0000269|PubMed:7756356}.

Sequence

MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL

Sequence length

729

Interactions

View interactions

	Reactome
			Proton/oligopeptide cotransporters

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Eczema	Eczema	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	25965825
Chronic Kidney Disease Mineral and Bone Disorder	Associate	27249515
Cystic Fibrosis	Associate	11809991
Glioma	Associate	30929128
Intellectual Disability	Associate	39586343
Kidney Diseases	Associate	28031405
Mitochondrial Diseases	Associate	40286765
Multiple Myeloma	Associate	31511451
Neoplasms	Associate	40286765
Porphyria Acute Intermittent	Associate	28031405

SLC15A2 (solute carrier family 15 member 2)