Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65264
Gene name Gene Name - the full gene name approved by the HGNC.
Ubiquitin conjugating enzyme E2 Z
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UBE2Z
Synonyms (NCBI Gene) Gene synonyms aliases
HOYS7, USE1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019617 hsa-miR-340-5p Sequencing 20371350
MIRT028379 hsa-miR-32-5p Sequencing 20371350
MIRT051172 hsa-miR-16-5p CLASH 23622248
MIRT048167 hsa-miR-196a-5p CLASH 23622248
MIRT047613 hsa-miR-10a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005515 Function Protein binding IPI 16189514, 24528925, 25416956, 32296183
GO:0005524 Function ATP binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 17464193
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611362 25847 ENSG00000159202
Protein
UniProt ID Q9H832
Protein name Ubiquitin-conjugating enzyme E2 Z (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Z) (Uba6-specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin-protein ligase Z)
Protein function Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation. {ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000269|PubMed
PDB 5A4P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00179 UQ_con 103 250 Ubiquitin-conjugating enzyme Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly in placenta, pancreas, spleen and testis. {ECO:0000269|PubMed:17160626, ECO:0000269|PubMed:17597759}.
Sequence
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGS
GLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMF
VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPN
FYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIR
VAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ubiquitin mediated proteolysis   Synthesis of active ubiquitin: roles of E1 and E2 enzymes
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary Heart Disease Coronary heart disease N/A N/A GWAS
Diabetes Type 2 diabetes or schizophrenia (pleiotropy), Type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Coronary Artery Disease Associate 24573017, 28710368, 28840129, 32685059
Coronary Stenosis Associate 32685059
Diabetes Mellitus Type 2 Associate 28840129, 32127821
Esophageal Neoplasms Associate 33794814
Frontotemporal Dementia Associate 25580532
Lung Diseases Associate 31262043
Obesity Associate 28840129