SLC3A2 (solute carrier family 3 member 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6520
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 3 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC3A2
Synonyms (NCBI Gene) Gene synonyms aliases
4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded tr
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(54)
miRTarBase ID miRNA Experiments Reference
MIRT029803 hsa-miR-26b-5p Microarray 19088304
MIRT031815 hsa-miR-16-5p Proteomics 18668040
MIRT049624 hsa-miR-92a-3p CLASH 23622248
MIRT047602 hsa-miR-10a-5p CLASH 23622248
MIRT041531 hsa-miR-193b-3p CLASH 23622248
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SP1 Unknown 17023546
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(40)
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0003725 Function Double-stranded RNA binding IDA 21266579
GO:0003824 Function Catalytic activity IEA
GO:0005432 Function Calcium:sodium antiporter activity TAS 10673541
GO:0005515 Function Protein binding IPI 10506149, 10631289, 12270127, 20374249, 25998567, 28298427, 30867591
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
158070 11026 ENSG00000168003
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P08195
Protein name Amino acid transporter heavy chain SLC3A2 (4F2 cell-surface antigen heavy chain) (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98)
Protein function Acts as a chaperone that facilitates biogenesis and trafficking of functional transporters heterodimers to the plasma membrane. Forms heterodimer with SLC7 family transporters (SLC7A5, SLC7A6, SLC7A7, SLC7A8, SLC7A10 and SLC7A11), a group of ami
PDB 2DH2 , 2DH3 , 6IRS , 6IRT , 6JMQ , 6JMR , 6S8V , 7B00 , 7CCS , 7CMH , 7CMI , 7DF1 , 7DSK , 7DSL , 7DSN , 7DSQ , 7EPZ , 7P9U , 7P9V , 8A6L , 8G0M , 8IDA , 8J8L , 8J8M , 8KDD , 8KDF , 8KDG , 8KDH , 8KDI , 8KDJ , 8KDN , 8KDO , 8KDP , 8QEY , 8WNS , 8WNT , 8WNY , 8X0W , 8XPU , 8YLP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16028 SLC3A2_N 145 → 225 Solute carrier family 3 member 2 N-terminus Family
PF00128 Alpha-amylase 239 → 325 Alpha amylase, catalytic domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-
Sequence 
MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPS
ASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEP
EKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVR
TRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGN
LAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKK
SIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFL
AEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT
QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALP
GQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD
FHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQ
PGREEGSPLELERLKLEPHEGLLLRFPYAA
Sequence length 630
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  mTOR signaling pathway
Ferroptosis
Protein digestion and absorption 		  Basigin interactions
Amino acid transport across the plasma membrane
Defective SLC7A7 causes lysinuric protein intolerance (LPI)
Tryptophan catabolism
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 26621329
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Alzheimer disease Alzheimer disease GWAS
Insomnia Insomnia GWAS
Show/Hide Text Mining Associations (61)
Associations from Text Mining
Disease Name Relationship Type References
Achalasia Addisonianism Alacrimia syndrome Stimulate 29545595
Adenocarcinoma of Lung Associate 33839363, 36793241, 37552140
Astrocytoma Associate 17329830
Bacterial Infections Associate 25701737
Breast Neoplasms Associate 10196234, 29545595, 29867227, 30066829, 31819174, 32093034, 32907912, 35501367, 37484811
Carcinogenesis Associate 15274339, 32093034
Carcinoma Embryonal Associate 32741077
Carcinoma Hepatocellular Associate 30470261
Carcinoma Ovarian Epithelial Associate 29267289
Carcinoma Pancreatic Ductal Associate 37479744