Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6520
Gene name	Solute carrier family 3 member 2
Gene symbol	SLC3A2
Synonyms (NCBI Gene)	4F24F2HC4T2HCCD98CD98HCMDU1NACAE
Chromosome	11
Chromosome location	11q12.3
Summary	This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded tr

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029803	hsa-miR-26b-5p	Microarray	19088304
MIRT031815	hsa-miR-16-5p	Proteomics	18668040
MIRT049624	hsa-miR-92a-3p	CLASH	23622248
MIRT047602	hsa-miR-10a-5p	CLASH	23622248
MIRT041531	hsa-miR-193b-3p	CLASH	23622248
MIRT052758	hsa-miR-1260b	CLASH	23622248
MIRT563436	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT333808	hsa-miR-4311	PAR-CLIP	20371350
MIRT563435	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT563434	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT333809	hsa-miR-8068	PAR-CLIP	20371350
MIRT563433	hsa-miR-6844	PAR-CLIP	20371350
MIRT439598	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT439598	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT563436	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT333808	hsa-miR-4311	PAR-CLIP	20371350
MIRT563435	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT563434	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT333809	hsa-miR-8068	PAR-CLIP	20371350
MIRT563433	hsa-miR-6844	PAR-CLIP	20371350
MIRT1363950	hsa-miR-1252	CLIP-seq
MIRT1363951	hsa-miR-2861	CLIP-seq
MIRT1363952	hsa-miR-3154	CLIP-seq
MIRT1363953	hsa-miR-4428	CLIP-seq
MIRT1363954	hsa-miR-4434	CLIP-seq
MIRT1363955	hsa-miR-4512	CLIP-seq
MIRT1363956	hsa-miR-4516	CLIP-seq
MIRT1363957	hsa-miR-4533	CLIP-seq
MIRT1363958	hsa-miR-4646-5p	CLIP-seq
MIRT1363959	hsa-miR-4727-3p	CLIP-seq
MIRT1363960	hsa-miR-4747-5p	CLIP-seq
MIRT1363961	hsa-miR-4786-3p	CLIP-seq
MIRT1363962	hsa-miR-661	CLIP-seq
MIRT1363963	hsa-miR-1275	CLIP-seq
MIRT1363964	hsa-miR-1909	CLIP-seq
MIRT1363965	hsa-miR-197	CLIP-seq
MIRT1363966	hsa-miR-3164	CLIP-seq
MIRT1363967	hsa-miR-3714	CLIP-seq
MIRT1363968	hsa-miR-412	CLIP-seq
MIRT1363969	hsa-miR-4260	CLIP-seq
MIRT1363970	hsa-miR-4493	CLIP-seq
MIRT1363971	hsa-miR-4665-5p	CLIP-seq
MIRT1363972	hsa-miR-570	CLIP-seq
MIRT1363963	hsa-miR-1275	CLIP-seq
MIRT1363973	hsa-miR-2276	CLIP-seq
MIRT1363969	hsa-miR-4260	CLIP-seq
MIRT1363971	hsa-miR-4665-5p	CLIP-seq
MIRT1363974	hsa-miR-4772-3p	CLIP-seq
MIRT1363966	hsa-miR-3164	CLIP-seq
MIRT1363967	hsa-miR-3714	CLIP-seq
MIRT1363970	hsa-miR-4493	CLIP-seq
MIRT1363966	hsa-miR-3164	CLIP-seq
MIRT1363967	hsa-miR-3714	CLIP-seq
MIRT1363970	hsa-miR-4493	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Unknown	17023546

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0005515	Function	Protein binding	IPI	9878049, 10506149, 10631289, 12270127, 20374249, 25998567, 28298427, 30341327, 30867591, 31160781, 32296183, 32814053, 33298890, 34880232, 35271311
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	11311135, 11557028, 12225859, 12270127, 23137377, 25998567, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006816	Process	Calcium ion transport	NAS	3036867
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS	10673541
GO:0009925	Component	Basal plasma membrane	ISS
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IDA	25063885
GO:0015173	Function	Aromatic amino acid transmembrane transporter activity	IGI	15589117
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IGI	17197568
GO:0015180	Function	L-alanine transmembrane transporter activity	IGI	10391915
GO:0015190	Function	L-leucine transmembrane transporter activity	IGI	10391915
GO:0015818	Process	Isoleucine transport	IDA	11311135, 11557028
GO:0015820	Process	L-leucine transport	IDA	9751058, 10574970, 11557028, 11564694, 12225859, 15769744
GO:0015820	Process	L-leucine transport	IEA
GO:0015820	Process	L-leucine transport	IMP	30341327
GO:0015821	Process	Methionine transport	IDA	11557028
GO:0015823	Process	Phenylalanine transport	IBA
GO:0015823	Process	Phenylalanine transport	IDA	9751058, 10574970, 11557028, 11564694
GO:0015823	Process	Phenylalanine transport	IEA
GO:0015823	Process	Phenylalanine transport	IGI	15589117
GO:0015824	Process	Proline transport	IDA	10574970
GO:0015827	Process	Tryptophan transport	IDA	10574970, 11557028, 11564694
GO:0015827	Process	Tryptophan transport	IEA
GO:0015827	Process	Tryptophan transport	ISS
GO:0015828	Process	Tyrosine transport	IDA	11557028, 11564694
GO:0015829	Process	Valine transport	IDA	11557028
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	3476959
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	31791063
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	31791063
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0042470	Component	Melanosome	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043330	Process	Response to exogenous dsRNA	IMP	21266579
GO:0044225	Component	Apical pole of neuron	IEA
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046718	Process	Symbiont entry into host cell	IMP	30341327
GO:0046982	Function	Protein heterodimerization activity	IDA	33298890
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0070327	Process	Thyroid hormone transport	IDA	11564694
GO:0140272	Function	Exogenous protein binding	IDA	30341327, 34294905
GO:1902024	Process	L-histidine transport	IDA	9751058, 11557028
GO:1903801	Process	L-leucine import across plasma membrane	IBA
GO:1903801	Process	L-leucine import across plasma membrane	IGI	10391915, 17197568
GO:1903801	Process	L-leucine import across plasma membrane	ISS
GO:1904273	Process	L-alanine import across plasma membrane	IBA
GO:1904273	Process	L-alanine import across plasma membrane	IGI	10391915
GO:1990184	Component	Amino acid transport complex	IDA	30867591

MIM	HGNC	e!Ensembl
158070	11026	ENSG00000168003

P08195

Protein name

Amino acid transporter heavy chain SLC3A2 (4F2 cell-surface antigen heavy chain) (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98)

Protein function

Acts as a chaperone that facilitates biogenesis and trafficking of functional transporters heterodimers to the plasma membrane. Forms heterodimer with SLC7 family transporters (SLC7A5, SLC7A6, SLC7A7, SLC7A8, SLC7A10 and SLC7A11), a group of ami

PDB

2DH2 , 2DH3 , 6IRS , 6IRT , 6JMQ , 6JMR , 6S8V , 7B00 , 7CCS , 7CMH , 7CMI , 7DF1 , 7DSK , 7DSL , 7DSN , 7DSQ , 7EPZ , 7P9U , 7P9V , 8A6L , 8G0M , 8IDA , 8J8L , 8J8M , 8KDD , 8KDF , 8KDG , 8KDH , 8KDI , 8KDJ , 8KDN , 8KDO , 8KDP , 8QEY , 8WNS , 8WNT , 8WNY , 8X0W , 8XPU , 8YLP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16028	SLC3A2_N	145 → 225	Solute carrier family 3 member 2 N-terminus	Family
PF00128	Alpha-amylase	239 → 325	Alpha amylase, catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-

Sequence

MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPS
ASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEP
EKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVR
TRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGN
LAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKK
SIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFL
AEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT
QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALP
GQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD
FHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQ
PGREEGSPLELERLKLEPHEGLLLRFPYAA

Sequence length

630

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Ferroptosis Protein digestion and absorption		Basigin interactions Amino acid transport across the plasma membrane Defective SLC7A7 causes lysinuric protein intolerance (LPI) Tryptophan catabolism

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
SLC3A2-related disorder	Likely benign	rs150850805	RCV003961858

Show/Hide Text Mining Associations (61)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achalasia Addisonianism Alacrimia syndrome	Stimulate	29545595
Adenocarcinoma of Lung	Associate	33839363, 36793241, 37552140
Astrocytoma	Associate	17329830
Bacterial Infections	Associate	25701737
Breast Neoplasms	Associate	10196234, 29545595, 29867227, 30066829, 31819174, 32093034, 32907912, 35501367, 37484811
Carcinogenesis	Associate	15274339, 32093034
Carcinoma Embryonal	Associate	32741077
Carcinoma Hepatocellular	Associate	30470261
Carcinoma Ovarian Epithelial	Associate	29267289
Carcinoma Pancreatic Ductal	Associate	37479744
Carcinoma Squamous Cell	Associate	19068093
Cartilage Diseases	Inhibit	36359826
Cell Transformation Viral	Associate	38267663
Choriocarcinoma	Associate	11742812
Colitis Ulcerative	Stimulate	25701737
Colorectal Neoplasms	Associate	17192196, 37559159
Crohn Disease	Stimulate	3040543
Dysplastic Nevus Syndrome	Associate	15274339
Fetal Growth Retardation	Stimulate	24886642
Focal Epithelial Hyperplasia of the Oral Mucosa	Associate	15274339
Gastro enteropancreatic neuroendocrine tumor	Associate	34182526
Genetic Diseases Inborn	Associate	9829974
Hereditary Angioedema Type III	Associate	35501367
Hereditary leiomyomatosis and renal cell cancer	Associate	21435201
Hypoxia	Stimulate	31269269
Inflammation	Associate	12181350, 37484811
Intervertebral Disc Degeneration	Associate	39735982
Laryngeal Neoplasms	Associate	26024742
Latent Infection	Associate	36214569
Leiomyoma	Associate	19808856
Lung Diseases Interstitial	Associate	10607488
Lung Neoplasms	Associate	26621329, 36793241
Lupus Erythematosus Systemic	Associate	26582197
Lupus Nephritis	Associate	34717796
Lymphatic Metastasis	Stimulate	32907912
Lysinuric Protein Intolerance	Associate	40106545, 9829974
Melanoma Cutaneous Malignant	Associate	35232428
Mouth Neoplasms	Associate	15274339
Neoplasm Metastasis	Associate	36930892
Neoplasms	Associate	11169447, 12181350, 17611393, 17711505, 26081836, 28239031, 29867227, 29909287, 32907912, 34024796, 34075107, 34182526, 36793241, 36930892, 37484811, 37728471 View all (1 more)
Neoplasms	Stimulate	28350098, 37559159
Nephrotic Syndrome	Associate	35173708
Neuronal Ceroid Lipofuscinoses	Associate	35506243
Obesity	Associate	36359826
Osteoarthritis	Associate	36359826
Osteosarcoma	Associate	28350098
Ovarian Neoplasms	Associate	17611393, 36930892
Pre Eclampsia	Stimulate	24886642
Prostatic Neoplasms	Associate	34075107
Small Cell Lung Carcinoma	Associate	12181350, 28448532
Smooth Muscle Tumor	Associate	19808856
Squamous Cell Carcinoma of Head and Neck	Associate	15274339, 37728471
Stomach Neoplasms	Stimulate	23116296
Stomach Neoplasms	Associate	28239031
Tongue Neoplasms	Associate	24762957
Triple Negative Breast Neoplasms	Associate	29545595
Triple Negative Breast Neoplasms	Stimulate	32907912
Urinary Bladder Neoplasms	Associate	26081836, 38267663
Virus Diseases	Associate	12181350
Waldenstrom Macroglobulinemia	Associate	32763516
Wiskott Aldrich Syndrome	Stimulate	8918565

SLC3A2 (solute carrier family 3 member 2)