Gene Gene information from NCBI Gene database.
Entrez ID 65110
Gene name UPF3A regulator of nonsense mediated mRNA decay
Gene symbol UPF3A
Synonyms (NCBI Gene)
HUPF3ARENT3AUPF3
Chromosome 13
Chromosome location 13q34
Summary This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs wit
miRNA miRNA information provided by mirtarbase database.
273
miRTarBase ID miRNA Experiments Reference
MIRT042322 hsa-miR-484 CLASH 23622248
MIRT042322 hsa-miR-484 CLASH 23622248
MIRT662870 hsa-miR-888-3p HITS-CLIP 23824327
MIRT662869 hsa-miR-6736-3p HITS-CLIP 23824327
MIRT662868 hsa-miR-6728-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay IDA 16601204
GO:0001701 Process In utero embryonic development IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IDA 11163187
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605530 20332 ENSG00000169062
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H1J1
Protein name Regulator of nonsense transcripts 3A (Nonsense mRNA reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3)
Protein function Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of
PDB 2L08 , 7QG6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03467 Smg4_UPF3 65 226 Smg-4/UPF3 family Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is strongly expressed in testis, uterus, muscle, fetal brain and spinal cord. Isoform 2 is strongly expressed in fetal brain and spinal cord. {ECO:0000269|PubMed:11113196}.
Sequence
MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPR
EEKRTALSKVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRN
PDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQKIAKKKLRKKDAKTGSIEDDPEYKKF
LETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKL
EKQRIREEKREERR
RRELEKKRLREEEKRRRREEERCKKKETDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKE
RGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQR
YHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMERLGRAQRC
DDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE
Sequence length 476
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Nucleocytoplasmic transport
mRNA surveillance pathway
  Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)