Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	65078
Gene name	Reticulon 4 receptor
Gene symbol	RTN4R
Synonyms (NCBI Gene)	NGRNOGOR
Chromosome	22
Chromosome location	22q11.21
Summary	This gene encodes the receptor for reticulon 4, oligodendrocyte myelin glycoprotein and myelin-associated glycoprotein. This receptor mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult centr

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT491729	hsa-miR-3186-5p	PAR-CLIP	23592263
MIRT491728	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT491727	hsa-miR-4767	PAR-CLIP	23592263
MIRT491726	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491725	hsa-miR-663a	PAR-CLIP	23592263
MIRT491724	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491723	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT491722	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT491720	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT491721	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT491719	hsa-miR-4651	PAR-CLIP	23592263
MIRT491718	hsa-miR-608	PAR-CLIP	23592263
MIRT491717	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT491716	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT491715	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT491729	hsa-miR-3186-5p	PAR-CLIP	23592263
MIRT491728	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT491727	hsa-miR-4767	PAR-CLIP	23592263
MIRT491726	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491725	hsa-miR-663a	PAR-CLIP	23592263
MIRT491724	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491723	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT491722	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT491720	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT491721	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT491719	hsa-miR-4651	PAR-CLIP	23592263
MIRT491718	hsa-miR-608	PAR-CLIP	23592263
MIRT491717	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT491716	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT491715	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT1322253	hsa-miR-10a	CLIP-seq
MIRT1322254	hsa-miR-10b	CLIP-seq
MIRT1322255	hsa-miR-1228	CLIP-seq
MIRT1322256	hsa-miR-1270	CLIP-seq
MIRT1322257	hsa-miR-1273f	CLIP-seq
MIRT1322258	hsa-miR-1293	CLIP-seq
MIRT1322259	hsa-miR-1299	CLIP-seq
MIRT1322260	hsa-miR-3064-5p	CLIP-seq
MIRT1322261	hsa-miR-30a	CLIP-seq
MIRT1322262	hsa-miR-30b	CLIP-seq
MIRT1322263	hsa-miR-30c	CLIP-seq
MIRT1322264	hsa-miR-30d	CLIP-seq
MIRT1322265	hsa-miR-30e	CLIP-seq
MIRT1322266	hsa-miR-342-5p	CLIP-seq
MIRT1322267	hsa-miR-3607-3p	CLIP-seq
MIRT1322268	hsa-miR-3663-3p	CLIP-seq
MIRT1322269	hsa-miR-3689a-3p	CLIP-seq
MIRT1322270	hsa-miR-3689c	CLIP-seq
MIRT1322271	hsa-miR-4467	CLIP-seq
MIRT1322272	hsa-miR-4483	CLIP-seq
MIRT1322273	hsa-miR-4632	CLIP-seq
MIRT1322274	hsa-miR-4663	CLIP-seq
MIRT1322275	hsa-miR-4664-5p	CLIP-seq
MIRT1322276	hsa-miR-4683	CLIP-seq
MIRT1322277	hsa-miR-4728-5p	CLIP-seq
MIRT1322278	hsa-miR-4782-5p	CLIP-seq
MIRT1322279	hsa-miR-495	CLIP-seq
MIRT1322280	hsa-miR-516b	CLIP-seq
MIRT1322281	hsa-miR-604	CLIP-seq
MIRT1322282	hsa-miR-620	CLIP-seq
MIRT1322283	hsa-miR-647	CLIP-seq
MIRT1322284	hsa-miR-875-3p	CLIP-seq
MIRT2393949	hsa-miR-1908	CLIP-seq
MIRT2393950	hsa-miR-663	CLIP-seq

Show/Hide all (59)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20463223, 20697954, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007409	Process	Axonogenesis	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IMP	16712417
GO:0009986	Component	Cell surface	IDA	16712417, 18411262, 20463223
GO:0009986	Component	Cell surface	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0022038	Process	Corpus callosum development	IEA
GO:0022038	Process	Corpus callosum development	ISS
GO:0023041	Process	Neuronal signal transduction	IEA
GO:0023041	Process	Neuronal signal transduction	ISS
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030517	Process	Negative regulation of axon extension	IEA
GO:0030517	Process	Negative regulation of axon extension	ISS
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IBA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IMP	16712417
GO:0035374	Function	Chondroitin sulfate binding	IEA
GO:0035374	Function	Chondroitin sulfate binding	ISS
GO:0038023	Function	Signaling receptor activity	ISS
GO:0038023	Function	Signaling receptor activity	NAS	11201742
GO:0038131	Function	Neuregulin receptor activity	IEA
GO:0038131	Function	Neuregulin receptor activity	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043198	Component	Dendritic shaft	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043547	Process	Positive regulation of GTPase activity	ISS
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0048681	Process	Negative regulation of axon regeneration	IEA
GO:0048681	Process	Negative regulation of axon regeneration	ISS
GO:0051963	Process	Regulation of synapse assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098552	Component	Side of membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA
GO:1905573	Function	Ganglioside GM1 binding	IBA
GO:1905573	Function	Ganglioside GM1 binding	IDA	18411262
GO:1905576	Function	Ganglioside GT1b binding	IBA
GO:1905576	Function	Ganglioside GT1b binding	IDA	18411262

MIM	HGNC	e!Ensembl
605566	18601	ENSG00000040608

Q9BZR6

Protein name

Reticulon-4 receptor (Nogo receptor) (NgR) (Nogo-66 receptor)

Protein function

Receptor for RTN4, OMG and MAG (PubMed:12037567, PubMed:12068310, PubMed:12089450, PubMed:12426574, PubMed:12839991, PubMed:16712417, PubMed:18411262, PubMed:19052207). Functions as a receptor for the sialylated gangliosides GT1b and GM1 (PubMed

PDB

1OZN , 1P8T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	114 → 166	Leucine rich repeat	Repeat
PF13855	LRR_8	156 → 214	Leucine rich repeat	Repeat
PF13855	LRR_8	203 → 261	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Widespread in the brain but highest levels in the gray matter. Low levels in heart and kidney; not expressed in oligodendrocytes (white matter). {ECO:0000269|PubMed:12694398}.

Sequence

MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQ
RIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRS
VDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNL
THLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSA
LPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKR
LAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALK
GRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCS
RKNRTRSHCRLGQAGSGGGGTGDSEGSGALPSLTCSLTPLGLALVLWTVLGPC

Sequence length

473

Interactions

View interactions

	Reactome
			Axonal growth inhibition (RHOA activation)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
RTN4R-related disorder	Likely benign; Uncertain significance	rs144464748, rs117955118, rs149052299, rs1309033080, rs1370988148, rs145150796, rs149231717, rs374126911	RCV003981609 RCV003893877 RCV003912144 RCV003951960 RCV003949509 RCV003924255 RCV003934348 RCV003979183
Schizophrenia	Uncertain significance	rs779384862	RCV003990901
Schizophrenia, susceptibility to	risk factor	rs74315508, rs74315509	RCV000005158 RCV000005159

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Autism Spectrum Disorder	Associate	28892071
Bipolar Disorder	Associate	27112568
Brain Neoplasms	Associate	31649250
Developmental Disabilities	Associate	28892071
Diabetes Mellitus Type 2	Associate	36357677
DiGeorge Syndrome	Associate	24321711
Glioblastoma	Associate	31649250
Glioma	Associate	15312170, 31649250
Glucose Intolerance	Associate	36357677
Leukemia Myeloid Acute	Associate	28965123
Leukoencephalopathies	Associate	24321711
Neoplasms	Associate	11407911, 31118164, 31547231
Psychotic Disorders	Associate	24321711
Schizophrenia	Associate	24321711, 28892071
Squamous Cell Carcinoma of Head and Neck	Associate	35886008

RTN4R (reticulon 4 receptor)