Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
65055
Gene name Gene Name - the full gene name approved by the HGNC.
Receptor accessory protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
REEP1
Synonyms (NCBI Gene) Gene synonyms aliases
C2orf23, DSMA6, HMN5B, HMND12, HMNR6, SPG31, Yip2a
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HMND12, HMNR6, SPG31
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918262 G>A,T Pathogenic Intron variant, 5 prime UTR variant, coding sequence variant, missense variant
rs121918263 G>A Pathogenic Intron variant, stop gained, coding sequence variant
rs139808535 C>T Conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant, intron variant
rs144874997 G>A Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, synonymous variant, intron variant
rs189652973 C>T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity 3 prime UTR variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024594 hsa-miR-215-5p Microarray 19074876
MIRT026266 hsa-miR-192-5p Microarray 19074876
MIRT636031 hsa-miR-33a-5p HITS-CLIP 23824327
MIRT636030 hsa-miR-33b-5p HITS-CLIP 23824327
MIRT303893 hsa-miR-507 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20200447, 23969831, 32296183
GO:0005737 Component Cytoplasm IDA 15550249
GO:0005783 Component Endoplasmic reticulum IDA 20200447
GO:0005789 Component Endoplasmic reticulum membrane IBA 21873635
GO:0005881 Component Cytoplasmic microtubule IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609139 25786 ENSG00000068615
Protein
UniProt ID Q9H902
Protein name Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Protein function Required for endoplasmic reticulum (ER) network formation, shaping and remodeling; it links ER tubules to the cytoskeleton. May also enhance the cell surface expression of odorant receptors (PubMed:20200447). May play a role in long-term axonal
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03134 TB2_DP1_HVA22 19 95 TB2/DP1, HVA22 family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in circumvallate papillae and testis. {ECO:0000269|PubMed:16720576}.
Sequence
MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLC
WFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPT
LSSKEKEIDDCLVQAKDRSYDALVH
FGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASG
KHGQPKMSRSASESASSSGTA
Sequence length 201
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Olfactory Signaling Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
30061737
Cardiomyopathy Cardiomyopathies rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
22703882
Distal hereditary motor neuronopathy Distal hereditary motor neuropathy type 5 rs104894345, rs104894351, rs137852970, rs137852972, rs267607143, rs267607145, rs28939680, rs29001571, rs28937568, rs28937569, rs104894020, rs121909112, rs121909113, rs121909342, rs786205090
View all (57 more)
Polyneuropathy Polyneuropathy, Motor rs1597597437
Unknown
Disease term Disease name Evidence References Source
Distal amyotrophy Distal amyotrophy ClinVar
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 30061737 ClinVar
Spastic tetraparesis Spastic tetraparesis ClinVar
Spastic Paraplegia hereditary spastic paraplegia 31 GenCC
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 30575323
Charcot Marie Tooth Disease Associate 34193129
Charcot Marie Tooth disease Type 4C Associate 34193129
Colorectal Neoplasms Associate 29453334
Multiple Sclerosis Associate 29908077
Multiple Sclerosis Chronic Progressive Associate 29908077
Neoplasm Metastasis Associate 30575323
Neuronopathy Distal Hereditary Motor Type V Associate 22703882, 34193129
Neuropathy hereditary motor and sensory Russe type Associate 34193129
Paraplegia Associate 18321925, 24986827