Gene Gene information from NCBI Gene database.
Entrez ID 6504
Gene name Signaling lymphocytic activation molecule family member 1
Gene symbol SLAMF1
Synonyms (NCBI Gene)
CD150CDw150IPO3SLAM
Chromosome 1
Chromosome location 1q23.3
miRNA miRNA information provided by mirtarbase database.
58
miRTarBase ID miRNA Experiments Reference
MIRT030083 hsa-miR-26b-5p Microarray 19088304
MIRT641305 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT641304 hsa-miR-3921 HITS-CLIP 23824327
MIRT641303 hsa-miR-4653-5p HITS-CLIP 23824327
MIRT641302 hsa-miR-4682 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
49
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IDA 10972291
GO:0001618 Function Virus receptor activity IEA
GO:0001779 Process Natural killer cell differentiation IEA
GO:0001787 Process Natural killer cell proliferation IEA
GO:0001818 Process Negative regulation of cytokine production IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603492 10903 ENSG00000117090
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13291
Protein name Signaling lymphocytic activation molecule (CDw150) (IPO-3) (SLAM family member 1) (CD antigen CD150)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
PDB 1D4T , 1D4W , 1I3Z , 1KA6 , 1KA7 , 1M27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06214 SLAM 1 125 Signaling lymphocytic activation molecule (SLAM) protein Family
Tissue specificity TISSUE SPECIFICITY: Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation (PubMed:7617038). Activated B-cells express isoform 1
Sequence
MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKN
VSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Virion - Ebolavirus, Lyssavirus and Morbillivirus
Measles