Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6504
Gene name Gene Name - the full gene name approved by the HGNC.	Signaling lymphocytic activation molecule family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLAMF1
Synonyms (NCBI Gene) Gene synonyms aliases	CD150, CDw150, IPO3, SLAM
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.3

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030083	hsa-miR-26b-5p	Microarray	19088304
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641299	hsa-miR-194-5p	HITS-CLIP	23824327
MIRT641298	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT641297	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT641296	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT641295	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT641294	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641293	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT641292	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT641291	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT641290	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT641289	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT641288	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT641287	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641299	hsa-miR-194-5p	HITS-CLIP	23824327
MIRT641298	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT641297	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT641296	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT641295	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT641294	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641293	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT641292	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT641291	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT641290	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT641289	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT641288	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT641287	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT1351471	hsa-miR-1825	CLIP-seq
MIRT1351472	hsa-miR-199a-5p	CLIP-seq
MIRT1351473	hsa-miR-199b-5p	CLIP-seq
MIRT1351474	hsa-miR-323-5p	CLIP-seq
MIRT1351475	hsa-miR-4302	CLIP-seq
MIRT1351476	hsa-miR-4456	CLIP-seq
MIRT1351477	hsa-miR-876-3p	CLIP-seq

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	10972291
GO:0001618	Function	Virus receptor activity	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001787	Process	Natural killer cell proliferation	IEA
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002277	Process	Myeloid dendritic cell activation involved in immune response	IDA	16317102
GO:0002376	Process	Immune system process	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	IEA
GO:0003823	Function	Antigen binding	TAS	7617038
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	7617038
GO:0005515	Function	Protein binding	IPI	9774102, 10549287, 11389028, 11477068, 11806999, 11823424, 12225753, 12545174, 14674764, 15841490, 16983070, 20231852, 22048310
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	10972291
GO:0005886	Component	Plasma membrane	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7617038
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0031338	Process	Regulation of vesicle fusion	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	IDA	16317102
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	16317102
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	16317102
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042169	Function	SH2 domain binding	IDA	9774102
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21217702, 21982860
GO:0045087	Process	Innate immune response	IEA
GO:0045321	Process	Leukocyte activation	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	20231852
GO:0046649	Process	Lymphocyte activation	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	20231852
GO:2000349	Process	Negative regulation of CD40 signaling pathway	IDA	16317102
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IEA
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IEA

MIM	HGNC	e!Ensembl
603492	10903	ENSG00000117090

Protein

UniProt ID

Q13291

Protein name

Signaling lymphocytic activation molecule (CDw150) (IPO-3) (SLAM family member 1) (CD antigen CD150)

Protein function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and

PDB

1D4T , 1D4W , 1I3Z , 1KA6 , 1KA7 , 1M27

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06214	SLAM	1 → 125	Signaling lymphocytic activation molecule (SLAM) protein	Family

Tissue specificity

TISSUE SPECIFICITY: Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation (PubMed:7617038). Activated B-cells express isoform 1

Sequence

MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES

Sequence length

335

Interactions

View interactions

	KEGG
	Virion - Ebolavirus, Lyssavirus and Morbillivirus Measles

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Eczema	Eczema	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Astrocytoma	Associate	25710480
Autoimmune Diseases	Associate	33987447
Central Nervous System Neoplasms	Associate	25710480
Cerebral Infarction	Associate	32746852, 36802116
Chromosome Aberrations	Inhibit	32578873
Colitis Ulcerative	Stimulate	33295628, 34298022
Colorectal Neoplasms	Associate	34467243
Communicable Diseases	Associate	11698444
Crohn Disease	Stimulate	33295628
Diabetes Mellitus Type 1	Stimulate	32983115
Endocrine System Diseases	Associate	32983115
Endometrial Neoplasms	Associate	36096644
Ependymoma	Associate	25710480
Epstein Barr Virus Infections	Stimulate	24238277
Fatigue Syndrome Chronic	Associate	26032326
Glioblastoma	Associate	25710480
Glioma	Associate	25710480
Graves Disease	Stimulate	33987447
Hashimoto Disease	Stimulate	32983115
Heavy Chain Disease	Associate	32826957
HIV Infections	Stimulate	22532682, 22713261
HTLV I Infections	Stimulate	22532682
Immunologic Deficiency Syndromes	Associate	25142143
Inflammation	Associate	31507593, 32983115, 33987447
Inflammatory Bowel Diseases	Associate	33295628
Leprosy	Associate	15356162
Leprosy Lepromatous	Associate	11698444
Leprosy Tuberculoid	Stimulate	11698444
Leukemia Lymphocytic Chronic B Cell	Associate	22194822, 26619119, 28982149, 32826957
Leukemia Prolymphocytic T Cell	Associate	32578873
Lupus Erythematosus Systemic	Associate	10225817, 23956418, 33828555
Lupus Erythematosus Systemic	Stimulate	29020082, 35603218
Lymphoma B Cell	Associate	24238277
Lymphoma B Cell Marginal Zone	Associate	29481902
Lymphoma Follicular	Associate	20220060
Lymphoproliferative Disorders	Associate	10607564, 11034354, 11823424, 22048771
Measles	Associate	22532682
Multiple Myeloma	Associate	26287276
Multiple Sclerosis	Associate	37072216
Myasthenia Gravis	Associate	24719132
Myasthenia Gravis Autoimmune Experimental	Associate	24719132
Mycobacterium avium intracellulare Infection	Associate	11698444, 15356162
Mycobacterium Infections Nontuberculous	Associate	15356162
Neoplasms	Associate	20220060, 34461858, 34467243
Ovarian Neoplasms	Associate	34461858
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	20220060
Pulmonary Disease Chronic Obstructive	Associate	36655999
Sarcoidosis	Associate	25142143
Sezary Syndrome	Associate	11168816
Skin Diseases	Associate	11698444
Tuberculosis	Stimulate	22713261
Tuberculosis Pulmonary	Associate	22713261

SLAMF1 (signaling lymphocytic activation molecule family member 1)