SLAMF1 (signaling lymphocytic activation molecule family member 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6504
Gene name Gene Name - the full gene name approved by the HGNC.
Signaling lymphocytic activation molecule family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLAMF1
Synonyms (NCBI Gene) Gene synonyms aliases
CD150, CDw150, IPO3, SLAM
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(58)
miRTarBase ID miRNA Experiments Reference
MIRT030083 hsa-miR-26b-5p Microarray 19088304
MIRT641305 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT641304 hsa-miR-3921 HITS-CLIP 23824327
MIRT641303 hsa-miR-4653-5p HITS-CLIP 23824327
MIRT641302 hsa-miR-4682 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(24)
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002277 Process Myeloid dendritic cell activation involved in immune response IDA 16317102
GO:0003823 Function Antigen binding TAS 7617038
GO:0004888 Function Transmembrane signaling receptor activity TAS 7617038
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603492 10903 ENSG00000117090
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q13291
Protein name Signaling lymphocytic activation molecule (CDw150) (IPO-3) (SLAM family member 1) (CD antigen CD150)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
PDB 1D4T , 1D4W , 1I3Z , 1KA6 , 1KA7 , 1M27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06214 SLAM 1 → 125 Signaling lymphocytic activation molecule (SLAM) protein Family
Tissue specificity TISSUE SPECIFICITY: Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation (PubMed:7617038). Activated B-cells express isoform 1
Sequence 
MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Virion - Ebolavirus, Lyssavirus and Morbillivirus
Measles 		 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Eczema Eczema GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Show/Hide Text Mining Associations (52)
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 25710480
Autoimmune Diseases Associate 33987447
Central Nervous System Neoplasms Associate 25710480
Cerebral Infarction Associate 32746852, 36802116
Chromosome Aberrations Inhibit 32578873
Colitis Ulcerative Stimulate 33295628, 34298022
Colorectal Neoplasms Associate 34467243
Communicable Diseases Associate 11698444
Crohn Disease Stimulate 33295628
Diabetes Mellitus Type 1 Stimulate 32983115