Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	65010
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 26 member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC26A6
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Alternatively spliced transcript varia

Show/Hide all(104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT733880	hsa-miR-411-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	33772775
MIRT733880	hsa-miR-411-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	33772775
MIRT733880	hsa-miR-411-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33772775
MIRT1357905	hsa-miR-1202	CLIP-seq
MIRT1357906	hsa-miR-1291	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357908	hsa-miR-217	CLIP-seq
MIRT1357909	hsa-miR-3194-5p	CLIP-seq
MIRT1357910	hsa-miR-339-5p	CLIP-seq
MIRT1357911	hsa-miR-3972	CLIP-seq
MIRT1357912	hsa-miR-4293	CLIP-seq
MIRT1357913	hsa-miR-125a-5p	CLIP-seq
MIRT1357914	hsa-miR-125b	CLIP-seq
MIRT1357915	hsa-miR-1289	CLIP-seq
MIRT1357916	hsa-miR-147	CLIP-seq
MIRT1357917	hsa-miR-1915	CLIP-seq
MIRT1357918	hsa-miR-219-1-3p	CLIP-seq
MIRT1357919	hsa-miR-3177-5p	CLIP-seq
MIRT1357920	hsa-miR-3198	CLIP-seq
MIRT1357921	hsa-miR-3667-3p	CLIP-seq
MIRT1357922	hsa-miR-4294	CLIP-seq
MIRT1357923	hsa-miR-4309	CLIP-seq
MIRT1357924	hsa-miR-4319	CLIP-seq
MIRT1357925	hsa-miR-432	CLIP-seq
MIRT1357926	hsa-miR-4682	CLIP-seq
MIRT1357927	hsa-miR-4726-3p	CLIP-seq
MIRT1357928	hsa-miR-4732-3p	CLIP-seq
MIRT1357929	hsa-miR-571	CLIP-seq
MIRT1357930	hsa-miR-670	CLIP-seq
MIRT1357931	hsa-miR-890	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT2330359	hsa-miR-3130-3p	CLIP-seq
MIRT2330360	hsa-miR-3173-5p	CLIP-seq
MIRT2330361	hsa-miR-4257	CLIP-seq
MIRT2330362	hsa-miR-520a-5p	CLIP-seq
MIRT2330363	hsa-miR-525-5p	CLIP-seq
MIRT2330364	hsa-miR-874	CLIP-seq
MIRT2440444	hsa-miR-1343	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357916	hsa-miR-147	CLIP-seq
MIRT1357918	hsa-miR-219-1-3p	CLIP-seq
MIRT2440445	hsa-miR-29a	CLIP-seq
MIRT2440446	hsa-miR-29b	CLIP-seq
MIRT2440447	hsa-miR-29c	CLIP-seq
MIRT2440448	hsa-miR-3132	CLIP-seq
MIRT2440449	hsa-miR-3135	CLIP-seq
MIRT1357919	hsa-miR-3177-5p	CLIP-seq
MIRT2440450	hsa-miR-3612	CLIP-seq
MIRT2440451	hsa-miR-4254	CLIP-seq
MIRT2440452	hsa-miR-4443	CLIP-seq
MIRT2440453	hsa-miR-4652-5p	CLIP-seq
MIRT1357926	hsa-miR-4682	CLIP-seq
MIRT2440454	hsa-miR-4802-3p	CLIP-seq
MIRT2440455	hsa-miR-4802-5p	CLIP-seq
MIRT1357929	hsa-miR-571	CLIP-seq
MIRT2440456	hsa-miR-619	CLIP-seq
MIRT2440457	hsa-miR-650	CLIP-seq
MIRT1357905	hsa-miR-1202	CLIP-seq
MIRT1357906	hsa-miR-1291	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357908	hsa-miR-217	CLIP-seq
MIRT1357909	hsa-miR-3194-5p	CLIP-seq
MIRT1357910	hsa-miR-339-5p	CLIP-seq
MIRT2624448	hsa-miR-3661	CLIP-seq
MIRT1357911	hsa-miR-3972	CLIP-seq
MIRT2440451	hsa-miR-4254	CLIP-seq
MIRT1357912	hsa-miR-4293	CLIP-seq
MIRT2440456	hsa-miR-619	CLIP-seq
MIRT2624449	hsa-miR-631	CLIP-seq
MIRT1357905	hsa-miR-1202	CLIP-seq
MIRT1357913	hsa-miR-125a-5p	CLIP-seq
MIRT1357914	hsa-miR-125b	CLIP-seq
MIRT1357915	hsa-miR-1289	CLIP-seq
MIRT1357906	hsa-miR-1291	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357916	hsa-miR-147	CLIP-seq
MIRT1357917	hsa-miR-1915	CLIP-seq
MIRT1357908	hsa-miR-217	CLIP-seq
MIRT1357918	hsa-miR-219-1-3p	CLIP-seq
MIRT1357919	hsa-miR-3177-5p	CLIP-seq
MIRT1357909	hsa-miR-3194-5p	CLIP-seq
MIRT1357920	hsa-miR-3198	CLIP-seq
MIRT1357910	hsa-miR-339-5p	CLIP-seq
MIRT2624448	hsa-miR-3661	CLIP-seq
MIRT1357921	hsa-miR-3667-3p	CLIP-seq
MIRT1357911	hsa-miR-3972	CLIP-seq
MIRT2440451	hsa-miR-4254	CLIP-seq
MIRT1357912	hsa-miR-4293	CLIP-seq
MIRT1357922	hsa-miR-4294	CLIP-seq
MIRT1357923	hsa-miR-4309	CLIP-seq
MIRT1357924	hsa-miR-4319	CLIP-seq
MIRT1357925	hsa-miR-432	CLIP-seq
MIRT2691032	hsa-miR-4539	CLIP-seq
MIRT2440453	hsa-miR-4652-5p	CLIP-seq
MIRT1357926	hsa-miR-4682	CLIP-seq
MIRT1357927	hsa-miR-4726-3p	CLIP-seq
MIRT1357928	hsa-miR-4732-3p	CLIP-seq
MIRT2440454	hsa-miR-4802-3p	CLIP-seq
MIRT2440455	hsa-miR-4802-5p	CLIP-seq
MIRT1357929	hsa-miR-571	CLIP-seq
MIRT2440456	hsa-miR-619	CLIP-seq
MIRT2624449	hsa-miR-631	CLIP-seq
MIRT1357930	hsa-miR-670	CLIP-seq
MIRT1357931	hsa-miR-890	CLIP-seq

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006811	Process	Ion transport	TAS
GO:0006821	Process	Chloride transport	IMP	20501439
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0008272	Process	Sulfate transport	IMP	20501439
GO:0008272	Process	Sulfate transport	ISS
GO:0012506	Component	Vesicle membrane	ISS
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IBA	21873635
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IMP	20501439
GO:0015106	Function	Bicarbonate transmembrane transporter activity	ISS
GO:0015108	Function	Chloride transmembrane transporter activity	IBA	21873635
GO:0015108	Function	Chloride transmembrane transporter activity	IMP	20501439
GO:0015108	Function	Chloride transmembrane transporter activity	ISS
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA	21873635
GO:0015116	Function	Sulfate transmembrane transporter activity	IMP	20501439
GO:0015301	Function	Anion:anion antiporter activity	IBA	21873635
GO:0015301	Function	Anion:anion antiporter activity	IMP	20501439
GO:0015301	Function	Anion:anion antiporter activity	ISS
GO:0015499	Function	Formate transmembrane transporter activity	ISS
GO:0015562	Function	Efflux transmembrane transporter activity	ISS
GO:0015660	Function	Formate efflux transmembrane transporter activity	ISS
GO:0015701	Process	Bicarbonate transport	IMP	20501439
GO:0015724	Process	Formate transport	ISS
GO:0015797	Process	Mannitol transport	ISS
GO:0016020	Component	Membrane	ISS
GO:0016021	Component	Integral component of membrane	IDA	11087667
GO:0016323	Component	Basolateral plasma membrane	IDA	11087667
GO:0016324	Component	Apical plasma membrane	IDA	11087667, 20501439
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA	21873635
GO:0019531	Function	Oxalate transmembrane transporter activity	IMP	20501439
GO:0019532	Process	Oxalate transport	IMP	20501439
GO:0019532	Process	Oxalate transport	ISS
GO:0030165	Function	PDZ domain binding	ISS
GO:0030321	Process	Transepithelial chloride transport	IMP	20501439
GO:0030321	Process	Transepithelial chloride transport	ISS
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031526	Component	Brush border membrane	IDA	11087667
GO:0031982	Component	Vesicle	ISS
GO:0034707	Component	Chloride channel complex	IEA
GO:0042045	Process	Epithelial fluid transport	ISS
GO:0046724	Process	Oxalic acid secretion	ISS
GO:0048240	Process	Sperm capacitation	ISS
GO:0050892	Process	Intestinal absorption	ISS
GO:0051453	Process	Regulation of intracellular pH	IMP	20501439
GO:0051454	Process	Intracellular pH elevation	ISS
GO:0070633	Process	Transepithelial transport	ISS
GO:0071320	Process	Cellular response to cAMP	ISS
GO:0071332	Process	Cellular response to fructose stimulus	ISS
GO:0071346	Process	Cellular response to interferon-gamma	IDA	18655181
GO:0097225	Component	Sperm midpiece	ISS
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:2001150	Process	Positive regulation of dipeptide transmembrane transport	ISS

MIM	HGNC	e!Ensembl
610068	14472	ENSG00000225697

Protein

UniProt ID

Q9BXS9

Protein name

Solute carrier family 26 member 6 (Anion exchange transporter) (Pendrin-like protein 1) (Pendrin-L1)

Protein function

Apical membrane anion-exchanger with wide epithelial distribution that plays a role as a component of the pH buffering system for maintaining acid-base homeostasis. Acts as a versatile DIDS-sensitive inorganic and organic anion transporter that

PDB

8OPQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	90 → 480	Sulfate permease family	Family
PF01740	STAS	531 → 738	STAS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highest levels in kidney and pancreas. Lower expression in heart, skeletal muscle, liver and placenta. Also found in lung and brain. {ECO:0000269|PubMed:11087667, ECO:0000269|PubMed:11247665}.; TISSUE SPECIFICITY: [Isoform

Sequence

MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWL
QCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAAR
VQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVT
FTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGV
KVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ
AASPKGASVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKA
LGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGH
FFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL

Sequence length

759

Interactions

View interactions

	KEGG		Reactome
	Mineral absorption Chemical carcinogenesis - reactive oxygen species		Multifunctional anion exchangers

SLC26A6 (solute carrier family 26 member 6)