Gene Gene information from NCBI Gene database.
Entrez ID 6498
Gene name SKI like proto-oncogene
Gene symbol SKIL
Synonyms (NCBI Gene)
SNOSnoASnoISnoN
Chromosome 3
Chromosome location 3q26.2
Summary The protein encoded by this gene is a component of the SMAD pathway, which regulates cell growth and differentiation through transforming growth factor-beta (TGFB). In the absence of ligand, the encoded protein binds to the promoter region of TGFB-respons
miRNA miRNA information provided by mirtarbase database.
915
miRTarBase ID miRNA Experiments Reference
MIRT022626 hsa-miR-124-3p Microarray 18668037
MIRT029466 hsa-miR-26b-5p Microarray 19088304
MIRT046162 hsa-miR-30b-5p CLASH 23622248
MIRT699523 hsa-miR-376c-3p HITS-CLIP 23313552
MIRT699522 hsa-miR-3925-5p HITS-CLIP 23313552
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SMAD4 Unknown 22674574
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
52
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10531062, 16966324, 17469184
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10531062
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
165340 10897 ENSG00000136603
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P12757
Protein name Ski-like protein (Ski-related oncogene) (Ski-related protein)
Protein function May have regulatory role in cell division or differentiation in response to extracellular signals.
PDB 3EQ5 , 5C4V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02437 Ski_Sno 128 235 SKI/SNO/DAC family Family
PF08782 c-SKI_SMAD_bind 261 355 c-SKI Smad4 binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform SNON and isoform SNOA are widely expressed. Highest expression is found in skeletal muscle, followed by placenta and lung. Lowest expression in heart, brain and pancreas. Isoform SNOI expression is restricted to skeletal muscle
Sequence
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEA
PVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTV
FLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLR
PRTFP
QNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAP
QTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKF
SMRSG
KRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVS
QSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASI
SNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLK
QQEKLNLILQKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQ
KDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQEREA
RQKLEMMIKELKLQILKSSKTAKE
Sequence length 684
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
  Downregulation of SMAD2/3:SMAD4 transcriptional activity
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920870 RCV000149067
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28115165
Adenoma Stimulate 19096149
Anodontia Associate 17062133
Arthritis Rheumatoid Associate 17594488
Atherosclerosis Associate 36457109
Breast Neoplasms Associate 28493978
Carcinogenesis Associate 17062133, 19096149, 23418461
Carcinoma Hepatocellular Associate 28230858
Carcinoma Ovarian Epithelial Stimulate 19383336
Castleman Disease Associate 34686774