Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64946
Gene name Gene Name - the full gene name approved by the HGNC.
Centromere protein H
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CENPH
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interpha
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT714732 hsa-miR-4668-3p HITS-CLIP 19536157
MIRT714731 hsa-miR-605-5p HITS-CLIP 19536157
MIRT714730 hsa-miR-3675-3p HITS-CLIP 19536157
MIRT714729 hsa-miR-3613-3p HITS-CLIP 19536157
MIRT714728 hsa-miR-8063 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
SP1 Activation 22682030
SP3 Activation 22682030
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000776 Component Kinetochore IBA 21873635
GO:0000776 Component Kinetochore IDA 11092768
GO:0000776 Component Kinetochore IMP 20212317
GO:0000776 Component Kinetochore NAS 11092768
GO:0000777 Component Condensed chromosome kinetochore IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605607 17268 ENSG00000153044
Protein
UniProt ID Q9H3R5
Protein name Centromere protein H (CENP-H) (Interphase centromere complex protein 35)
Protein function Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal)
PDB 7PB4 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05837 CENP-H 126 239 Centromere protein H (CENP-H) Domain
Sequence
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSM
VDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKIS
RQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKN
KQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQ
L
EKNVDMM
Sequence length 247
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Deposition of new CENPA-containing nucleosomes at the centromere
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 18700042
Adenocarcinoma of Lung Associate 31731374
Allan Herndon Dudley syndrome Associate 18700042
Breast Neoplasms Associate 21880184
Carcinogenesis Associate 19500341
Carcinoma Non Small Cell Lung Associate 19170237
Colorectal Neoplasms Associate 30658502, 37328854
Esophageal Neoplasms Associate 18700042
Lung Neoplasms Stimulate 19170237
Nasopharyngeal Carcinoma Associate 22682030