Gene Gene information from NCBI Gene database.
Entrez ID 64689
Gene name Golgi reassembly stacking protein 1
Gene symbol GORASP1
Synonyms (NCBI Gene)
GOLPH5GRASP65P65
Chromosome 3
Chromosome location 3p22.2
Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a c
miRNA miRNA information provided by mirtarbase database.
337
miRTarBase ID miRNA Experiments Reference
MIRT639574 hsa-miR-3529-3p HITS-CLIP 23824327
MIRT639573 hsa-miR-4773 HITS-CLIP 23824327
MIRT639572 hsa-miR-516a-3p HITS-CLIP 23824327
MIRT639571 hsa-miR-516b-3p HITS-CLIP 23824327
MIRT639570 hsa-miR-7162-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 16489344, 18045989, 25416956, 26871637, 31515488, 32296183, 32353859, 33060197, 36217030
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 18045989
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606867 16769 ENSG00000114745
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQQ3
Protein name Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi phosphoprotein 5) (GOLPH5) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65)
Protein function Key structural protein of the Golgi apparatus (PubMed:33301566). The membrane cisternae of the Golgi apparatus adhere to each other to form stacks, which are aligned side by side to form the Golgi ribbon (PubMed:33301566). Acting in concert with
PDB 4REY , 6G8T , 6G8W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04495 GRASP55_65 1 91 GRASP55/65 PDZ-like domain Domain
PF04495 GRASP55_65 69 205 GRASP55/65 PDZ-like domain Domain
Sequence
MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLK
ANVEKPVK
LEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEP
SSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTP
NAAWGGEGSLGCGIGYGYLHRIPTQ
PPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPED
SPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ
RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEAT
WSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG
LDTGTEAEGLDSQAQISTTE
Sequence length 440
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Autophagy - animal   Golgi Cisternae Pericentriolar Stack Reorganization
COPII-mediated vesicle transport
COPI-mediated anterograde transport
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Clear cell carcinoma of kidney Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 22491060
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Associate 24977159
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Associate 22491060
★☆☆☆☆
Found in Text Mining only
Neoplasm Metastasis Associate 22491060
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 22491060, 24977159, 31770410
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Associate 31770410
★☆☆☆☆
Found in Text Mining only