Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6468
Gene name	F-box and WD repeat domain containing 4
Gene symbol	FBXW4
Synonyms (NCBI Gene)	DACFBW4FBWD4SHFM3SHSF3
Chromosome	10
Chromosome location	10q24.32
Summary	This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for mainta

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments
MIRT993427	hsa-miR-1288	CLIP-seq
MIRT993428	hsa-miR-1343	CLIP-seq
MIRT993429	hsa-miR-15a	CLIP-seq
MIRT993430	hsa-miR-15b	CLIP-seq
MIRT993431	hsa-miR-16	CLIP-seq
MIRT993432	hsa-miR-195	CLIP-seq
MIRT993433	hsa-miR-214	CLIP-seq
MIRT993434	hsa-miR-217	CLIP-seq
MIRT993435	hsa-miR-3126-5p	CLIP-seq
MIRT993436	hsa-miR-3179	CLIP-seq
MIRT993437	hsa-miR-3192	CLIP-seq
MIRT993438	hsa-miR-3199	CLIP-seq
MIRT993439	hsa-miR-326	CLIP-seq
MIRT993440	hsa-miR-330-5p	CLIP-seq
MIRT993441	hsa-miR-3619-5p	CLIP-seq
MIRT993442	hsa-miR-3689a-3p	CLIP-seq
MIRT993443	hsa-miR-3689c	CLIP-seq
MIRT993444	hsa-miR-3914	CLIP-seq
MIRT993445	hsa-miR-424	CLIP-seq
MIRT993446	hsa-miR-4314	CLIP-seq
MIRT993447	hsa-miR-4422	CLIP-seq
MIRT993448	hsa-miR-4490	CLIP-seq
MIRT993449	hsa-miR-4646-5p	CLIP-seq
MIRT993450	hsa-miR-4677-3p	CLIP-seq
MIRT993451	hsa-miR-4679	CLIP-seq
MIRT993452	hsa-miR-4688	CLIP-seq
MIRT993453	hsa-miR-4722-3p	CLIP-seq
MIRT993454	hsa-miR-4728-5p	CLIP-seq
MIRT993455	hsa-miR-4747-5p	CLIP-seq
MIRT993456	hsa-miR-4774-5p	CLIP-seq
MIRT993457	hsa-miR-486-3p	CLIP-seq
MIRT993458	hsa-miR-497	CLIP-seq
MIRT993459	hsa-miR-515-5p	CLIP-seq
MIRT993460	hsa-miR-761	CLIP-seq
MIRT1994671	hsa-miR-4732-3p	CLIP-seq
MIRT1994672	hsa-miR-4755-5p	CLIP-seq
MIRT1994673	hsa-miR-670	CLIP-seq
MIRT2228765	hsa-miR-128	CLIP-seq
MIRT2228766	hsa-miR-1915	CLIP-seq
MIRT2228767	hsa-miR-1972	CLIP-seq
MIRT2228768	hsa-miR-3137	CLIP-seq
MIRT2228769	hsa-miR-330-3p	CLIP-seq
MIRT2228770	hsa-miR-371b-3p	CLIP-seq
MIRT2228771	hsa-miR-4433	CLIP-seq
MIRT2228772	hsa-miR-4645-5p	CLIP-seq
MIRT2228773	hsa-miR-4673	CLIP-seq
MIRT2228774	hsa-miR-4717-5p	CLIP-seq
MIRT2228775	hsa-miR-4726-3p	CLIP-seq
MIRT2228776	hsa-miR-665	CLIP-seq
MIRT2532315	hsa-miR-204	CLIP-seq
MIRT2532316	hsa-miR-211	CLIP-seq
MIRT2532317	hsa-miR-3121-5p	CLIP-seq
MIRT2228769	hsa-miR-330-3p	CLIP-seq
MIRT2532318	hsa-miR-4731-5p	CLIP-seq
MIRT1994672	hsa-miR-4755-5p	CLIP-seq
MIRT2532319	hsa-miR-548aa	CLIP-seq
MIRT2532320	hsa-miR-548p	CLIP-seq
MIRT2532321	hsa-miR-578	CLIP-seq
MIRT2532322	hsa-miR-607	CLIP-seq
MIRT2532323	hsa-miR-623	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	NAS	10945468
GO:0005515	Function	Protein binding	IPI	22632967, 27705803, 32814053, 33961781
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	10945468
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0030326	Process	Embryonic limb morphogenesis	NAS	10405324
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA

MIM	HGNC	e!Ensembl
608071	10847	ENSG00000107829

P57775

Protein name

F-box/WD repeat-containing protein 4 (Dactylin) (F-box and WD-40 domain-containing protein 4)

Protein function

Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. Likely to be involved in key signaling pathways crucial for normal limb development. May participate in Wnt signaling.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	28 → 74	F-box-like	Domain
PF00400	WD40	192 → 227	WD domain, G-beta repeat	Repeat
PF00400	WD40	326 → 365	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, kidney, lung and liver. {ECO:0000269|PubMed:10405324}.

Sequence

MAAAAGEEEEEEEAARESAARPAAGPALWRLPEELLLLICSYLDMRALGRLAQVCRWLRR
FTSCDLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQ
MPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAG
GDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSGSRDRTAKVWPLASGRLGQCLHT
IQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVM
YESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHLLATGSSYYGV
VRLWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFQNP

Sequence length

412

Interactions

View interactions

	Reactome
			Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Ectrodactyly	Conflicting classifications of pathogenicity; Uncertain significance	rs560966094, rs886046646, rs768227529, rs562226127	RCV003231439 RCV003231440 RCV003231438 RCV003231437
FBXW4-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	rs759980303, rs770271071, rs145250200, rs116070021, rs143070839	RCV003946295 RCV003973616 RCV003909949 RCV003957451 RCV003898094
See cases	Uncertain significance	rs2063780508, rs1393527867	RCV001197544 RCV001197545
Split hand-foot malformation 3	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	rs61761937, rs111600818, rs61382490, rs35614606, rs570558261, rs80085258, rs771930157, rs771654851, rs886046642, rs117664315, rs77990860, rs535051082, rs200476624, rs886046647, rs557225276 View all (25 more)	RCV000358964 RCV000260916 RCV000332509 RCV000386693 RCV000358153 RCV000318955 RCV000290035 RCV000341386 RCV000301943 RCV000367332 RCV000326478 RCV000375859 RCV000317650 RCV000378646 RCV000286623 RCV000260220 RCV000347076 RCV000390675 RCV000307611 RCV000305669 RCV000388549 RCV000295831 RCV000348381 RCV000406645 RCV000353355 RCV000275032 RCV000327765 RCV000287818 RCV001106368 RCV001106369 RCV001106370 RCV001108578 RCV001108579 RCV001103408 RCV001103409 RCV001103411 RCV001105333 RCV001105334 RCV001106462 RCV001103410

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	35589867
Colorectal Neoplasms	Associate	34373442
Glioma	Associate	39377096
Neoplasms	Associate	39377096

FBXW4 (F-box and WD repeat domain containing 4)