EBF2 (EBF transcription factor 2)

Gene

• Entrez ID: 64641
• Gene name: EBF transcription factor 2
• Gene symbol: EBF2
• Synonyms (NCBI Gene): COE2, EBF-2, O/E-3, OE-3
• Chromosome: 8
• Chromosome location: 8p21.2
• Summary: The protein encoded by this gene belongs to the COE (Collier/Olf/EBF) family of non-basic, helix-loop-helix transcription factors that have a well conserved DNA binding domain. The COE family proteins play an important role in variety of developmental pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1981810	hsa-miR-1206	CLIP-seq
MIRT1981811	hsa-miR-299-3p	CLIP-seq
MIRT1981812	hsa-miR-3607-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001709	Process	Cell fate determination	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26844207

Other IDs

• MIM: 609934
• HGNC: 19090
• e!Ensembl: ENSG00000221818

Protein

• UniProt ID: Q9HAK2
• Protein name: Transcription factor COE2 (Early B-cell factor 2) (EBF-2)
• Protein function: Transcription factor that, in osteoblasts, activates the decoy receptor for RANKL, TNFRSF11B, which in turn regulates osteoclast differentiation. Acts in synergy with the Wnt-responsive LEF1/CTNNB1 pathway. Recognizes variations of the palindrom
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16422	COE1_DBD	16 → 246	Transcription factor COE1 DNA-binding domain	Domain
  PF01833	TIG	253 → 335	IPT/TIG domain	Domain
  PF16423	COE1_HLH	338 → 381	Transcription factor COE1 helix-loop-helix domain	Domain

• Sequence:

  MFGIQDTLGRGPTLKEKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSN
  LRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVR
  TEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPV
  IIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHG
  RRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHA
  IRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGD
  PERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQLPALSSSPA
  HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMN
  GYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKS
  AFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM

• Sequence length: 575