Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
646
Gene name Gene Name - the full gene name approved by the HGNC.
Basonuclin zinc finger protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BNC1
Synonyms (NCBI Gene) Gene synonyms aliases
BNC, BSN1, HsT19447, POF16, bn1
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a zinc finger protein present in the basal cell layer of the epidermis and in hair follicles. It is also found in abundance in the germ cells of testis and ovary. This protein is thought to play a regulatory role in keratinocyte prolifer
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1596591051 GGCCC>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018429 hsa-miR-335-5p Microarray 18185580
MIRT029748 hsa-miR-26b-5p Microarray 19088304
MIRT823244 hsa-miR-132 CLIP-seq
MIRT823245 hsa-miR-194 CLIP-seq
MIRT823246 hsa-miR-212 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000182 Function RDNA binding IDA 10449744, 11152639
GO:0001216 Function DNA-binding transcription activator activity IDA 11152639
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 30010909
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601930 1081 ENSG00000169594
Protein
UniProt ID Q01954
Protein name Zinc finger protein basonuclin-1
Protein function Transcriptional activator (By similarity). It is likely involved in the regulation of keratinocytes terminal differentiation in squamous epithelia and hair follicles (PubMed:8034748). Required for the maintenance of spermatogenesis (By similarit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 357 378 Domain
PF00096 zf-C2H2 928 951 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: In epidermis, primarily detected in cells of the basal or immediately suprabasal layers (at protein level) (PubMed:16891417). In hair follicles, mainly expressed in the outer root sheath (at protein level) (PubMed:8034748). Expressed i
Sequence
MRRRPPSRGGRGAARARETRRQPRHRSGRRMAEAISCTLNCSCQSFKPGKINHRQCDQCK
HGWVAHALSKLRIPPMYPTSQVEIVQSNVVFDISSLMLYGTQAIPVRLKILLDRLFSVLK
QDEVLQILHALDWTLQDYIRGYVLQDASGKVLDHWSIMTSEEEVATLQQFLRFGETKSIV
ELMAIQEKEEQSIIIPPSTANVDIRAFIESCSHRSSSLPTPVDKGNPSSIHPFENLISNM
TFMLPFQFFNPLPPALIGSLPEQYMLEQGHDQSQDPKQEVHGPFPDSSFLTSSSTPFQVE
KDQCLNCPDAITKKEDSTHLSDSSSYNIVTKFERTQLSPEAKVKPERNSLGTKKGRVFCT
ACEKTFYDKGTLKIHYNA
VHLKIKHKCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMNRN
NRDKDLRNSLNLASSENYKCPGFTVTSPDCRPPPSYPGSGEDSKGQPAFPNIGQNGVLFP
NLKTVQPVLPFYRSPATPAEVANTPGILPSLPLLSSSIPEQLISNEMPFDALPKKKSRKS
SMPIKIEKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGK
PFPEGERPCHRESVIESSGAISQTPEQATHNSERETEQTPALIMVPREVEDGGHEHYFTP
GMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRF
QCDICKKTFKNACSVKIHHKNMHVKEMHTCTVEGCNATFPSRRSRDRHSSNLNLHQKALS
QEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSA
SLESYNSGPLSEGTILDLSTTSSMKSESSSHSSWDSDGVSEEGTVLMEDSDGNCEGSSLV
PGEDEYPICVLMEKADQSLASLPSGLPITCHLCQKTYSNKGTFRAHYKTVHLRQLHKCKV
PGCNTMFSSVRSRNRHSQNPNLHKSLASSPSHLQ
Sequence length 994
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Premature Ovarian Failure Premature ovarian failure 16 rs1596591051 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gonadal Dysgenesis 46 XX gonadal dysgenesis N/A N/A GenCC
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32360590
Ataxia Telangiectasia Associate 19430199
Carcinogenesis Associate 26821013
Carcinoma Hepatocellular Inhibit 26821013
Carcinoma Renal Cell Associate 20154727, 24454902
Colorectal Neoplasms Associate 26291085
Esophageal Squamous Cell Carcinoma Stimulate 37705202
Infertility Female Associate 38614076
Leukemia Associate 19430199
Leukemia Lymphocytic Chronic B Cell Associate 20484983