Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64581
Gene name Gene Name - the full gene name approved by the HGNC.	C-type lectin domain containing 7A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CLEC7A
Synonyms (NCBI Gene) Gene synonyms aliases	BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunorec

Show/Hide all(344)

miRTarBase ID	miRNA	Experiments	Reference
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT675432	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT675431	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT675430	hsa-miR-5693	HITS-CLIP	23824327
MIRT675429	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT675428	hsa-miR-4284	HITS-CLIP	23824327
MIRT675427	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT675426	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT675425	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT675424	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT675423	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT675422	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT675421	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT675420	hsa-miR-7977	HITS-CLIP	23824327
MIRT675419	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT675418	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT675417	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT675416	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT675415	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT675414	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT675413	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT675412	hsa-miR-3689c	HITS-CLIP	23824327
MIRT675411	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT675410	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT675409	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT540614	hsa-miR-4537	PAR-CLIP	21572407
MIRT540613	hsa-miR-377-5p	PAR-CLIP	21572407
MIRT540612	hsa-miR-6086	PAR-CLIP	21572407
MIRT540610	hsa-miR-4746-3p	PAR-CLIP	21572407
MIRT540611	hsa-miR-4792	PAR-CLIP	21572407
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711136	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT711135	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711134	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711133	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT675432	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT675431	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT675430	hsa-miR-5693	HITS-CLIP	23824327
MIRT675429	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT675428	hsa-miR-4284	HITS-CLIP	23824327
MIRT675427	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT675426	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT675425	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT675424	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT675423	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT675422	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT675421	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT675420	hsa-miR-7977	HITS-CLIP	23824327
MIRT675419	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT675418	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT675417	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT675416	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT675415	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT675414	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT675413	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT675412	hsa-miR-3689c	HITS-CLIP	23824327
MIRT675411	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT675410	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT675409	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT540614	hsa-miR-4537	PAR-CLIP	21572407
MIRT540613	hsa-miR-377-5p	PAR-CLIP	21572407
MIRT540612	hsa-miR-6086	PAR-CLIP	21572407
MIRT540610	hsa-miR-4746-3p	PAR-CLIP	21572407
MIRT540611	hsa-miR-4792	PAR-CLIP	21572407
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT896167	hsa-miR-24	CLIP-seq
MIRT896168	hsa-miR-3122	CLIP-seq
MIRT896169	hsa-miR-3184	CLIP-seq
MIRT896170	hsa-miR-3197	CLIP-seq
MIRT896171	hsa-miR-323-5p	CLIP-seq
MIRT896172	hsa-miR-3607-3p	CLIP-seq
MIRT896173	hsa-miR-3609	CLIP-seq
MIRT896174	hsa-miR-3613-3p	CLIP-seq
MIRT896175	hsa-miR-3686	CLIP-seq
MIRT896176	hsa-miR-371-5p	CLIP-seq
MIRT896177	hsa-miR-371b-5p	CLIP-seq
MIRT896178	hsa-miR-3913-5p	CLIP-seq
MIRT896179	hsa-miR-3934	CLIP-seq
MIRT896180	hsa-miR-423-5p	CLIP-seq
MIRT896181	hsa-miR-4455	CLIP-seq
MIRT896182	hsa-miR-4514	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT896184	hsa-miR-4656	CLIP-seq
MIRT896185	hsa-miR-4692	CLIP-seq
MIRT896186	hsa-miR-4786-5p	CLIP-seq
MIRT896187	hsa-miR-548ah	CLIP-seq
MIRT896188	hsa-miR-550a	CLIP-seq
MIRT896189	hsa-miR-769-5p	CLIP-seq
MIRT896190	hsa-miR-876-3p	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT896192	hsa-miR-1273e	CLIP-seq
MIRT896193	hsa-miR-1303	CLIP-seq
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT896194	hsa-miR-2114	CLIP-seq
MIRT896167	hsa-miR-24	CLIP-seq
MIRT896195	hsa-miR-2964a-3p	CLIP-seq
MIRT896196	hsa-miR-302f	CLIP-seq
MIRT896168	hsa-miR-3122	CLIP-seq
MIRT896169	hsa-miR-3184	CLIP-seq
MIRT896172	hsa-miR-3607-3p	CLIP-seq
MIRT896197	hsa-miR-3622b-5p	CLIP-seq
MIRT896198	hsa-miR-3647-3p	CLIP-seq
MIRT896175	hsa-miR-3686	CLIP-seq
MIRT896199	hsa-miR-3691-3p	CLIP-seq
MIRT896178	hsa-miR-3913-5p	CLIP-seq
MIRT896200	hsa-miR-3929	CLIP-seq
MIRT896180	hsa-miR-423-5p	CLIP-seq
MIRT896201	hsa-miR-4419b	CLIP-seq
MIRT896202	hsa-miR-4433	CLIP-seq
MIRT896203	hsa-miR-4453	CLIP-seq
MIRT896204	hsa-miR-4459	CLIP-seq
MIRT896205	hsa-miR-4470	CLIP-seq
MIRT896206	hsa-miR-4478	CLIP-seq
MIRT896182	hsa-miR-4514	CLIP-seq
MIRT896207	hsa-miR-4538	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT896208	hsa-miR-4653-3p	CLIP-seq
MIRT896184	hsa-miR-4656	CLIP-seq
MIRT896185	hsa-miR-4692	CLIP-seq
MIRT896209	hsa-miR-4722-5p	CLIP-seq
MIRT896210	hsa-miR-4768-3p	CLIP-seq
MIRT896186	hsa-miR-4786-5p	CLIP-seq
MIRT896211	hsa-miR-485-5p	CLIP-seq
MIRT896212	hsa-miR-501-3p	CLIP-seq
MIRT896213	hsa-miR-502-3p	CLIP-seq
MIRT896214	hsa-miR-505	CLIP-seq
MIRT896215	hsa-miR-665	CLIP-seq
MIRT896216	hsa-miR-890	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT896217	hsa-miR-943	CLIP-seq
MIRT896192	hsa-miR-1273e	CLIP-seq
MIRT1965693	hsa-miR-1285	CLIP-seq
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT1965694	hsa-miR-1915	CLIP-seq
MIRT896195	hsa-miR-2964a-3p	CLIP-seq
MIRT896196	hsa-miR-302f	CLIP-seq
MIRT1965695	hsa-miR-3180	CLIP-seq
MIRT1965696	hsa-miR-3180-3p	CLIP-seq
MIRT1965697	hsa-miR-3187-5p	CLIP-seq
MIRT1965698	hsa-miR-3196	CLIP-seq
MIRT1965699	hsa-miR-335	CLIP-seq
MIRT896173	hsa-miR-3609	CLIP-seq
MIRT896200	hsa-miR-3929	CLIP-seq
MIRT1965700	hsa-miR-4325	CLIP-seq
MIRT896201	hsa-miR-4419b	CLIP-seq
MIRT896205	hsa-miR-4470	CLIP-seq
MIRT896206	hsa-miR-4478	CLIP-seq
MIRT1965701	hsa-miR-4480	CLIP-seq
MIRT1965702	hsa-miR-4488	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT1965703	hsa-miR-4697-5p	CLIP-seq
MIRT896209	hsa-miR-4722-5p	CLIP-seq
MIRT896210	hsa-miR-4768-3p	CLIP-seq
MIRT896211	hsa-miR-485-5p	CLIP-seq
MIRT1965704	hsa-miR-495	CLIP-seq
MIRT1965705	hsa-miR-508-5p	CLIP-seq
MIRT1965706	hsa-miR-520g	CLIP-seq
MIRT1965707	hsa-miR-520h	CLIP-seq
MIRT896187	hsa-miR-548ah	CLIP-seq
MIRT1965708	hsa-miR-555	CLIP-seq
MIRT1965709	hsa-miR-612	CLIP-seq
MIRT1965710	hsa-miR-658	CLIP-seq
MIRT1965711	hsa-miR-661	CLIP-seq
MIRT1965712	hsa-miR-766	CLIP-seq
MIRT896216	hsa-miR-890	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT896217	hsa-miR-943	CLIP-seq
MIRT2201617	hsa-miR-1227	CLIP-seq
MIRT896192	hsa-miR-1273e	CLIP-seq
MIRT1965693	hsa-miR-1285	CLIP-seq
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT1965694	hsa-miR-1915	CLIP-seq
MIRT896194	hsa-miR-2114	CLIP-seq
MIRT896167	hsa-miR-24	CLIP-seq
MIRT896195	hsa-miR-2964a-3p	CLIP-seq
MIRT896196	hsa-miR-302f	CLIP-seq
MIRT896168	hsa-miR-3122	CLIP-seq
MIRT1965695	hsa-miR-3180	CLIP-seq
MIRT1965696	hsa-miR-3180-3p	CLIP-seq
MIRT896169	hsa-miR-3184	CLIP-seq
MIRT1965697	hsa-miR-3187-5p	CLIP-seq
MIRT1965698	hsa-miR-3196	CLIP-seq
MIRT1965699	hsa-miR-335	CLIP-seq
MIRT896172	hsa-miR-3607-3p	CLIP-seq
MIRT896175	hsa-miR-3686	CLIP-seq
MIRT896178	hsa-miR-3913-5p	CLIP-seq
MIRT896200	hsa-miR-3929	CLIP-seq
MIRT896180	hsa-miR-423-5p	CLIP-seq
MIRT2201618	hsa-miR-4252	CLIP-seq
MIRT1965700	hsa-miR-4325	CLIP-seq
MIRT896201	hsa-miR-4419b	CLIP-seq
MIRT896202	hsa-miR-4433	CLIP-seq
MIRT896204	hsa-miR-4459	CLIP-seq
MIRT896206	hsa-miR-4478	CLIP-seq
MIRT1965702	hsa-miR-4488	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT2201619	hsa-miR-4652-3p	CLIP-seq
MIRT896184	hsa-miR-4656	CLIP-seq
MIRT1965703	hsa-miR-4697-5p	CLIP-seq
MIRT896209	hsa-miR-4722-5p	CLIP-seq
MIRT896210	hsa-miR-4768-3p	CLIP-seq
MIRT2201620	hsa-miR-4793-3p	CLIP-seq
MIRT896211	hsa-miR-485-5p	CLIP-seq
MIRT1965704	hsa-miR-495	CLIP-seq
MIRT1965705	hsa-miR-508-5p	CLIP-seq
MIRT1965708	hsa-miR-555	CLIP-seq
MIRT1965709	hsa-miR-612	CLIP-seq
MIRT1965710	hsa-miR-658	CLIP-seq
MIRT1965711	hsa-miR-661	CLIP-seq
MIRT1965712	hsa-miR-766	CLIP-seq
MIRT896216	hsa-miR-890	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT896195	hsa-miR-2964a-3p	CLIP-seq
MIRT896196	hsa-miR-302f	CLIP-seq
MIRT896200	hsa-miR-3929	CLIP-seq
MIRT1965700	hsa-miR-4325	CLIP-seq
MIRT896201	hsa-miR-4419b	CLIP-seq
MIRT896206	hsa-miR-4478	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT896209	hsa-miR-4722-5p	CLIP-seq
MIRT896210	hsa-miR-4768-3p	CLIP-seq
MIRT896211	hsa-miR-485-5p	CLIP-seq
MIRT1965705	hsa-miR-508-5p	CLIP-seq
MIRT896188	hsa-miR-550a	CLIP-seq
MIRT1965712	hsa-miR-766	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT2504481	hsa-miR-10a	CLIP-seq
MIRT2504482	hsa-miR-10b	CLIP-seq
MIRT896192	hsa-miR-1273e	CLIP-seq
MIRT1965693	hsa-miR-1285	CLIP-seq
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT1965694	hsa-miR-1915	CLIP-seq
MIRT896195	hsa-miR-2964a-3p	CLIP-seq
MIRT896196	hsa-miR-302f	CLIP-seq
MIRT2504483	hsa-miR-3120-5p	CLIP-seq
MIRT896168	hsa-miR-3122	CLIP-seq
MIRT1965697	hsa-miR-3187-5p	CLIP-seq
MIRT1965699	hsa-miR-335	CLIP-seq
MIRT2504484	hsa-miR-339-5p	CLIP-seq
MIRT896172	hsa-miR-3607-3p	CLIP-seq
MIRT896173	hsa-miR-3609	CLIP-seq
MIRT896174	hsa-miR-3613-3p	CLIP-seq
MIRT2504485	hsa-miR-3664-5p	CLIP-seq
MIRT896175	hsa-miR-3686	CLIP-seq
MIRT896176	hsa-miR-371-5p	CLIP-seq
MIRT896177	hsa-miR-371b-5p	CLIP-seq
MIRT896178	hsa-miR-3913-5p	CLIP-seq
MIRT896200	hsa-miR-3929	CLIP-seq
MIRT1965700	hsa-miR-4325	CLIP-seq
MIRT896201	hsa-miR-4419b	CLIP-seq
MIRT2504486	hsa-miR-4421	CLIP-seq
MIRT896206	hsa-miR-4478	CLIP-seq
MIRT896182	hsa-miR-4514	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT2504487	hsa-miR-4684-5p	CLIP-seq
MIRT896185	hsa-miR-4692	CLIP-seq
MIRT896209	hsa-miR-4722-5p	CLIP-seq
MIRT896210	hsa-miR-4768-3p	CLIP-seq
MIRT896186	hsa-miR-4786-5p	CLIP-seq
MIRT896211	hsa-miR-485-5p	CLIP-seq
MIRT1965704	hsa-miR-495	CLIP-seq
MIRT1965705	hsa-miR-508-5p	CLIP-seq
MIRT1965706	hsa-miR-520g	CLIP-seq
MIRT1965707	hsa-miR-520h	CLIP-seq
MIRT896187	hsa-miR-548ah	CLIP-seq
MIRT2504488	hsa-miR-593	CLIP-seq
MIRT1965709	hsa-miR-612	CLIP-seq
MIRT1965711	hsa-miR-661	CLIP-seq
MIRT1965712	hsa-miR-766	CLIP-seq
MIRT896189	hsa-miR-769-5p	CLIP-seq
MIRT896216	hsa-miR-890	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT896217	hsa-miR-943	CLIP-seq
MIRT2504481	hsa-miR-10a	CLIP-seq
MIRT2504482	hsa-miR-10b	CLIP-seq
MIRT896192	hsa-miR-1273e	CLIP-seq
MIRT1965693	hsa-miR-1285	CLIP-seq
MIRT896166	hsa-miR-1827	CLIP-seq
MIRT896195	hsa-miR-2964a-3p	CLIP-seq
MIRT896196	hsa-miR-302f	CLIP-seq
MIRT2504483	hsa-miR-3120-5p	CLIP-seq
MIRT896168	hsa-miR-3122	CLIP-seq
MIRT1965697	hsa-miR-3187-5p	CLIP-seq
MIRT1965699	hsa-miR-335	CLIP-seq
MIRT2504484	hsa-miR-339-5p	CLIP-seq
MIRT896172	hsa-miR-3607-3p	CLIP-seq
MIRT896173	hsa-miR-3609	CLIP-seq
MIRT896174	hsa-miR-3613-3p	CLIP-seq
MIRT2504485	hsa-miR-3664-5p	CLIP-seq
MIRT896175	hsa-miR-3686	CLIP-seq
MIRT896176	hsa-miR-371-5p	CLIP-seq
MIRT896177	hsa-miR-371b-5p	CLIP-seq
MIRT896178	hsa-miR-3913-5p	CLIP-seq
MIRT896200	hsa-miR-3929	CLIP-seq
MIRT1965700	hsa-miR-4325	CLIP-seq
MIRT896201	hsa-miR-4419b	CLIP-seq
MIRT2504486	hsa-miR-4421	CLIP-seq
MIRT896206	hsa-miR-4478	CLIP-seq
MIRT896183	hsa-miR-4649-3p	CLIP-seq
MIRT2504487	hsa-miR-4684-5p	CLIP-seq
MIRT896209	hsa-miR-4722-5p	CLIP-seq
MIRT896210	hsa-miR-4768-3p	CLIP-seq
MIRT896186	hsa-miR-4786-5p	CLIP-seq
MIRT896211	hsa-miR-485-5p	CLIP-seq
MIRT1965704	hsa-miR-495	CLIP-seq
MIRT1965705	hsa-miR-508-5p	CLIP-seq
MIRT1965706	hsa-miR-520g	CLIP-seq
MIRT1965707	hsa-miR-520h	CLIP-seq
MIRT896187	hsa-miR-548ah	CLIP-seq
MIRT2504488	hsa-miR-593	CLIP-seq
MIRT1965709	hsa-miR-612	CLIP-seq
MIRT1965711	hsa-miR-661	CLIP-seq
MIRT1965712	hsa-miR-766	CLIP-seq
MIRT896189	hsa-miR-769-5p	CLIP-seq
MIRT896216	hsa-miR-890	CLIP-seq
MIRT896191	hsa-miR-940	CLIP-seq
MIRT896217	hsa-miR-943	CLIP-seq

Show/Hide all(95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001775	Process	Cell activation	ISS
GO:0001872	Function	(1->3)-beta-D-glucan binding	IBA
GO:0001872	Function	(1->3)-beta-D-glucan binding	IDA	22267217, 24721111
GO:0001872	Function	(1->3)-beta-D-glucan binding	IEA
GO:0001872	Function	(1->3)-beta-D-glucan binding	ISS
GO:0001872	Function	(1->3)-beta-D-glucan binding	TAS	25251945
GO:0001878	Process	Response to yeast	ISS
GO:0001879	Process	Detection of yeast	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IBA
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	ISS
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IDA	19358895
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 23674515, 25416956, 31515488, 31875558, 32296183
GO:0005737	Component	Cytoplasm	IDA	24721111
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	25251945
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006910	Process	Phagocytosis, recognition	IBA
GO:0006910	Process	Phagocytosis, recognition	IDA	11567029
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008037	Process	Cell recognition	IDA	11567029
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	24721111
GO:0009756	Process	Carbohydrate mediated signaling	TAS	11567029
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	24721111, 25251945
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	19358895
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11567029
GO:0016046	Process	Detection of fungus	IDA	19358895
GO:0016046	Process	Detection of fungus	IEA
GO:0030246	Function	Carbohydrate binding	IDA	11567029
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	24721111
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	22267217
GO:0032491	Process	Detection of molecule of fungal origin	IDA	19358895
GO:0032491	Process	Detection of molecule of fungal origin	IEA
GO:0032491	Process	Detection of molecule of fungal origin	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IDA	19358895
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	22267217
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	19358895
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	19358895
GO:0032743	Process	Positive regulation of interleukin-2 production	IDA	19358895
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032747	Process	Positive regulation of interleukin-23 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19358895
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	25251945
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	19358895
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	19358895
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0038187	Function	Pattern recognition receptor activity	IDA	11567029
GO:0038187	Function	Pattern recognition receptor activity	IEA
GO:0038187	Function	Pattern recognition receptor activity	ISS
GO:0042110	Process	T cell activation	TAS	11567029
GO:0042287	Function	MHC protein binding	NAS	11567029
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042832	Process	Defense response to protozoan	NAS	11567029
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IBA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11053425, 18223652, 18287044
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045321	Process	Leukocyte activation	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	19358895
GO:0046872	Function	Metal ion binding	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IDA	19358895
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	ISS
GO:0051251	Process	Positive regulation of lymphocyte activation	IDA	19358895
GO:0060267	Process	Positive regulation of respiratory burst	IDA	19358895
GO:0061760	Process	Antifungal innate immune response	ISS
GO:0070884	Process	Regulation of calcineurin-NFAT signaling cascade	ISS
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	ISS
GO:0071226	Process	Cellular response to molecule of fungal origin	IDA	22267217
GO:0071226	Process	Cellular response to molecule of fungal origin	IEA
GO:0071226	Process	Cellular response to molecule of fungal origin	ISS
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IMP	25251945
GO:0090303	Process	Positive regulation of wound healing	IMP	24721111
GO:0097190	Process	Apoptotic signaling pathway	IMP	22267217
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	22267217
GO:1903431	Process	Positive regulation of cell maturation	IDA	19358895
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS

MIM	HGNC	e!Ensembl
606264	14558	ENSG00000172243

Protein

UniProt ID

Q9BXN2

Protein name

C-type lectin domain family 7 member A (Beta-glucan receptor) (C-type lectin superfamily member 12) (Dendritic cell-associated C-type lectin 1) (DC-associated C-type lectin 1) (Dectin-1) (CD antigen CD369)

Protein function

Lectin that functions as a pattern recognizing receptor (PRR) specific for beta-1,3-linked and beta-1,6-linked glucans, which constitute cell wall constituents from pathogenic bacteria and fungi (PubMed:11567029, PubMed:12423684). Necessary for

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	137 → 243	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta. {ECO:0000269|PubMed:11470510, ECO:0000269|PubMed:11491532, ECO:0000269|PubMed:11567029, ECO:00002

Sequence

MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPC
PPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
CEKKFSM

Sequence length

247

Interactions

View interactions

	KEGG		Reactome
	Phagosome Neutrophil extracellular trap formation C-type lectin receptor signaling pathway Tuberculosis		CLEC7A (Dectin-1) signaling

CLEC7A (C-type lectin domain containing 7A)