Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64400
Gene name Gene Name - the full gene name approved by the HGNC.
AKT interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AKTIP
Synonyms (NCBI Gene) Gene synonyms aliases
FT1, FTS
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
The mouse homolog of this gene produces fused toes and thymic hyperplasia in heterozygous mutant animals while homozygous mutants die in early development. This gene may play a role in apoptosis as these morphological abnormalities are caused by altered p
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT040167 hsa-miR-615-3p CLASH 23622248
MIRT053408 hsa-miR-629-5p Microarray 23807165
MIRT441241 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT441239 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT441238 hsa-miR-541-5p HITS-CLIP 24374217
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IDA 14749367
GO:0005515 Function Protein binding IPI 16189514, 18799622, 23414517, 25416956, 31515488, 32073997, 32296183, 33961781, 34882091
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IDA 14749367
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608483 16710 ENSG00000166971
Protein
UniProt ID Q9H8T0
Protein name AKT-interacting protein (Ft1) (Fused toes protein homolog)
Protein function Component of the FTS/Hook/FHIP complex (FHF complex) (PubMed:32073997). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). Regulates apoptosis by enha
PDB 8QAT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00179 UQ_con 78 217 Ubiquitin-conjugating enzyme Domain
Sequence
MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPITKPTSPAPAA
QSTNGTHASYGPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDG
VFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMY
ARRVFYKIDTASPLNPEAAVLYEKDIQLFKSKVVDSV
KVCTARLFDQPKIEDPYAISFSP
WNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVAT
Sequence length 292
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bipolar Disorder Associate 20132317
Breast Neoplasms Associate 36516775
Carcinoma Squamous Cell Associate 27765929
Endometrial Neoplasms Associate 23028188
Muscular Dystrophy Duchenne Associate 1505987
Neoplasms Inhibit 23028188
Neoplasms Associate 36516775
Ovarian Neoplasms Associate 20635389
Uterine Cervical Neoplasms Associate 25151576, 27765929