Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6428
Gene name Gene Name - the full gene name approved by the HGNC.
Serine and arginine rich splicing factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SRSF3
Synonyms (NCBI Gene) Gene synonyms aliases
SFRS3, SRp20
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31-p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020093 hsa-miR-361-5p Sequencing 20371350
MIRT021093 hsa-miR-186-5p Sequencing 20371350
MIRT022320 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT455619 hsa-miR-3129-3p PAR-CLIP 23592263
MIRT455617 hsa-miR-5583-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IBA 21873635
GO:0000398 Process MRNA splicing, via spliceosome TAS
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA 21873635
GO:0003723 Function RNA binding IDA 26876937
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603364 10785 ENSG00000112081
Protein
UniProt ID P84103
Protein name Serine/arginine-rich splicing factor 3 (Pre-mRNA-splicing factor SRP20) (Splicing factor, arginine/serine-rich 3)
Protein function Splicing factor, which binds the consensus motif 5'-C[ACU][AU]C[ACU][AC]C-3' within pre-mRNA and promotes specific exons inclusion during alternative splicing (PubMed:17036044, PubMed:26876937, PubMed:32440474). Interaction with YTHDC1, a RNA-bi
PDB 2I2Y , 2I38 , 9ASQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 77 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVR
VELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Sequence length 164
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome
Amyotrophic lateral sclerosis
Herpes simplex virus 1 infection
  Transport of Mature mRNA derived from an Intron-Containing Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Glaucoma Glaucoma GWAS
Uterine Fibroids Uterine Fibroids GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 22788679
Brain Ischemia Associate 38196192
Breast Neoplasms Associate 26367347, 31138601, 31828152
Carcinogenesis Inhibit 22777358
Carcinogenesis Associate 26416554, 27429590, 27984373, 37558679
Carcinoma Hepatocellular Associate 30637779, 36499164
Carcinoma Non Small Cell Lung Associate 38216996
Carcinoma Ovarian Epithelial Associate 20856201
Colorectal Neoplasms Associate 24284797, 29138007, 32719950, 33142236, 36691026
Colorectal Neoplasms Stimulate 27282379