Gene Gene information from NCBI Gene database.
Entrez ID 6428
Gene name Serine and arginine rich splicing factor 3
Gene symbol SRSF3
Synonyms (NCBI Gene)
SFRS3SRp20
Chromosome 6
Chromosome location 6p21.31-p21.2
Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for
miRNA miRNA information provided by mirtarbase database.
574
miRTarBase ID miRNA Experiments Reference
MIRT020093 hsa-miR-361-5p Sequencing 20371350
MIRT021093 hsa-miR-186-5p Sequencing 20371350
MIRT022320 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT455619 hsa-miR-3129-3p PAR-CLIP 23592263
MIRT455617 hsa-miR-5583-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IDA 26876937
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603364 10785 ENSG00000112081
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P84103
Protein name Serine/arginine-rich splicing factor 3 (Pre-mRNA-splicing factor SRP20) (Splicing factor, arginine/serine-rich 3)
Protein function Splicing factor, which binds the consensus motif 5'-C[ACU][AU]C[ACU][AC]C-3' within pre-mRNA and promotes specific exons inclusion during alternative splicing (PubMed:17036044, PubMed:26876937, PubMed:32440474). Interaction with YTHDC1, a RNA-bi
PDB 2I2Y , 2I38 , 9ASQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 77 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVR
VELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Sequence length 164
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome
Amyotrophic lateral sclerosis
Herpes simplex virus 1 infection
  Transport of Mature mRNA derived from an Intron-Containing Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination