Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64219
Gene name Gene Name - the full gene name approved by the HGNC.	Praja ring finger ubiquitin ligase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PJA1
Synonyms (NCBI Gene) Gene synonyms aliases	PRAJA1, RNF70
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an enzyme that has E2-dependent E3 ubiquitin-protein ligase activity. This enzyme belongs to a class of ubiquitin ligases that include a RING finger motif, and it can interact with the E2 ubiquitin-conjugating enzyme UbcH5B. This gene is

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments
MIRT1237086	hsa-miR-155	CLIP-seq
MIRT1237087	hsa-miR-190	CLIP-seq
MIRT1237088	hsa-miR-190b	CLIP-seq
MIRT1237089	hsa-miR-1976	CLIP-seq
MIRT1237090	hsa-miR-2053	CLIP-seq
MIRT1237091	hsa-miR-335	CLIP-seq
MIRT1237092	hsa-miR-3682-3p	CLIP-seq
MIRT1237093	hsa-miR-4721	CLIP-seq
MIRT1237094	hsa-miR-4775	CLIP-seq
MIRT1237095	hsa-miR-498	CLIP-seq
MIRT1237096	hsa-miR-509-3p	CLIP-seq
MIRT1237097	hsa-miR-569	CLIP-seq
MIRT1237098	hsa-miR-587	CLIP-seq
MIRT1237099	hsa-miR-194	CLIP-seq
MIRT1237089	hsa-miR-1976	CLIP-seq
MIRT1237090	hsa-miR-2053	CLIP-seq
MIRT1237100	hsa-miR-3120-3p	CLIP-seq
MIRT1237101	hsa-miR-3136-5p	CLIP-seq
MIRT1237102	hsa-miR-323-3p	CLIP-seq
MIRT1237091	hsa-miR-335	CLIP-seq
MIRT1237103	hsa-miR-4439	CLIP-seq
MIRT1237104	hsa-miR-4513	CLIP-seq
MIRT1237093	hsa-miR-4721	CLIP-seq
MIRT1237105	hsa-miR-4752	CLIP-seq
MIRT1237094	hsa-miR-4775	CLIP-seq
MIRT1237106	hsa-miR-489	CLIP-seq
MIRT1237095	hsa-miR-498	CLIP-seq
MIRT1237096	hsa-miR-509-3p	CLIP-seq
MIRT1237097	hsa-miR-569	CLIP-seq
MIRT1237107	hsa-miR-577	CLIP-seq
MIRT1237098	hsa-miR-587	CLIP-seq
MIRT1237108	hsa-miR-802	CLIP-seq
MIRT2069723	hsa-miR-4731-3p	CLIP-seq
MIRT2069724	hsa-miR-4801	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20864041, 28514442, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
300420	16648	ENSG00000181191

Protein

UniProt ID

Q8NG27

Protein name

E3 ubiquitin-protein ligase Praja-1 (Praja1) (EC 2.3.2.27) (RING finger protein 70) (RING-type E3 ubiquitin transferase Praja-1)

Protein function

Has E2-dependent E3 ubiquitin-protein ligase activity. Ubiquitinates MAGED1 antigen leading to its subsequent degradation by proteasome (By similarity). May be involved in protein sorting.

PDB

2L0B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	593 → 636	Ring finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various regions of the brain including the cerebellum, cerebral cortex, medulla, occipital pole, frontal lobe, temporal lobe and putamen. Highest levels in the cerebral cortex. {ECO:0000269|PubMed:12036302}.

Sequence

MGQESSKPVWPNPTGGYQSNTGRRYGRRHAYVSFRPPTSQRERIASQRKTNSEVPMHRSA
PSQTTKRSRSPFSTTRRSWDDSESSGTNLNIDNEDYSRYPPREYRASGSRRGMAYGHIDS
YGADDSEEEGAGPVERPPVRGKTGKFKDDKLYDPEKGARSLAGPPPHFSSFSRDVREERD
KLDPVPAARCSASRADFLPQSSVASQSSSEGKLATKGDSSERERREQNLPARPSRAPVSI
CGGGENTSKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDDDDMPHSTSRWRDTANDNEGH
SDGLARRGRGESSSGYPEPKYPEDKREARSDQVKPEKVPRRRRTMADPDFWTHSDDYYKY
CDEDSDSDKEWIAALRRKYRSREQTLSSSGESWETLPGKEEREPPQAKVSASTGTSPGPG
ASASAGAGAGASAGSNGSNYLEEVREPSLQEEQASLEEGEIPWLQYHENDSSSEGDNDSG
HELMQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMAL
EERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCS
EYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL

Sequence length

643

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	11533224

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Schizophrenia	Schizophrenia			GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Cleft Lip	Associate	28877219
Muscular Dystrophy Duchenne	Associate	28877219

PJA1 (praja ring finger ubiquitin ligase 1)