SELENOP (selenoprotein P)

Gene

• Entrez ID: 6414
• Gene name: Selenoprotein P
• Gene symbol: SELENOP
• Synonyms (NCBI Gene): SELP, SEPP, SEPP1, SeP
• Chromosome: 5
• Chromosome location: 5p12
• Summary: This gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (10 in human), and accounts for most of th

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001887	Process	Selenium compound metabolic process	IBA
GO:0001887	Process	Selenium compound metabolic process	IEA
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006979	Process	Response to oxidative stress	TAS
GO:0007420	Process	Brain development	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008430	Function	Selenium binding	IBA
GO:0008430	Function	Selenium binding	IEA
GO:0008430	Function	Selenium binding	TAS	8421687
GO:0009791	Process	Post-embryonic development	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0019953	Process	Sexual reproduction	IEA
GO:0031089	Component	Platelet dense granule lumen	TAS
GO:0040008	Process	Regulation of growth	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145

Other IDs

• MIM: 601484
• HGNC: 10751
• e!Ensembl: ENSG00000250722

Protein

• UniProt ID: P49908
• Protein name: Selenoprotein P (SeP)
• Protein function: Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04592	SelP_N	23 → 248	Selenoprotein P, N terminal region	Family
  PF04593	SelP_C	251 → 381	Selenoprotein P, C terminal region	Family

• Tissue specificity: TISSUE SPECIFICITY: Made in the liver and heart and secreted into the plasma. It is also found in the kidney.
• Sequence:

  MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUY
  LCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQ
  TDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTL
  KDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAP
  PGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSU
  CCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIP
  TEASASURUKNQAKKUEUPSN

• Sequence length: 381

Pathways

Reactome:

Platelet degranulation