Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64061
Gene name	TSPY like 2
Gene symbol	TSPYL2
Synonyms (NCBI Gene)	CDA1CINAPCTCLDENTTHRIHFB2216NP79SE204TSPX
Chromosome	X
Chromosome location	Xp11.22
Summary	This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle pr

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004680	hsa-miR-15a-5p	Luciferase reporter assay	19478946
MIRT016836	hsa-miR-335-5p	Microarray	18185580
MIRT044649	hsa-miR-320a	CLASH	23622248
MIRT1460238	hsa-miR-15a	CLIP-seq
MIRT1460239	hsa-miR-15b	CLIP-seq
MIRT1460240	hsa-miR-16	CLIP-seq
MIRT1460241	hsa-miR-195	CLIP-seq
MIRT1460242	hsa-miR-424	CLIP-seq
MIRT1460243	hsa-miR-4524	CLIP-seq
MIRT1460244	hsa-miR-4706	CLIP-seq
MIRT1460245	hsa-miR-4734	CLIP-seq
MIRT1460246	hsa-miR-4749-5p	CLIP-seq
MIRT1460247	hsa-miR-497	CLIP-seq
MIRT1460248	hsa-miR-503	CLIP-seq
MIRT1460249	hsa-miR-582-5p	CLIP-seq
MIRT1460250	hsa-miR-596	CLIP-seq
MIRT1460251	hsa-miR-646	CLIP-seq
MIRT1460252	hsa-miR-744	CLIP-seq
MIRT2138174	hsa-miR-3150b-3p	CLIP-seq
MIRT2138175	hsa-miR-4784	CLIP-seq
MIRT1460238	hsa-miR-15a	CLIP-seq
MIRT1460239	hsa-miR-15b	CLIP-seq
MIRT1460240	hsa-miR-16	CLIP-seq
MIRT1460241	hsa-miR-195	CLIP-seq
MIRT2359153	hsa-miR-3180	CLIP-seq
MIRT2359154	hsa-miR-3180-3p	CLIP-seq
MIRT2359155	hsa-miR-3196	CLIP-seq
MIRT2359156	hsa-miR-3926	CLIP-seq
MIRT1460242	hsa-miR-424	CLIP-seq
MIRT2359157	hsa-miR-4488	CLIP-seq
MIRT1460243	hsa-miR-4524	CLIP-seq
MIRT2359158	hsa-miR-4697-5p	CLIP-seq
MIRT1460244	hsa-miR-4706	CLIP-seq
MIRT1460245	hsa-miR-4734	CLIP-seq
MIRT1460246	hsa-miR-4749-5p	CLIP-seq
MIRT1460247	hsa-miR-497	CLIP-seq
MIRT1460248	hsa-miR-503	CLIP-seq
MIRT1460250	hsa-miR-596	CLIP-seq
MIRT1460251	hsa-miR-646	CLIP-seq
MIRT2359159	hsa-miR-658	CLIP-seq
MIRT1460252	hsa-miR-744	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000182	Function	RDNA binding	NAS	11395479
GO:0000785	Component	Chromatin	IBA
GO:0003682	Function	Chromatin binding	IBA
GO:0005515	Function	Protein binding	IPI	26496610, 28514442, 32296183, 32707033, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11395479
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	11395479
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	IEA
GO:0008156	Process	Negative regulation of DNA replication	IDA	11395479
GO:0009966	Process	Regulation of signal transduction	NAS	11395479
GO:0030308	Process	Negative regulation of cell growth	IDA	11395479
GO:0042393	Function	Histone binding	IBA
GO:0045786	Process	Negative regulation of cell cycle	NAS	11395479
GO:0045859	Process	Regulation of protein kinase activity	IDA	11395479

MIM	HGNC	e!Ensembl
300564	24358	ENSG00000184205

Q9H2G4

Protein name

Testis-specific Y-encoded-like protein 2 (TSPY-like protein 2) (Cell division autoantigen 1) (Cutaneous T-cell lymphoma-associated antigen se20-4) (CTCL-associated antigen se20-4) (Differentially-expressed nucleolar TGF-beta1 target protein) (Nuclear prot

Protein function

Part of the CASK/TBR1/TSPYL2 transcriptional complex which modulates gene expression in response to neuronal synaptic activity, probably by facilitating nucleosome assembly. May inhibit cell proliferation by inducing p53-dependent CDKN1A express

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00956	NAP	259 → 426	Nucleosome assembly protein (NAP)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in brain, testis and heart, and lowest levels in liver and pancreas. {ECO:0000269|PubMed:11149944, ECO:0000269|PubMed:11318608, ECO:0000269|PubMed:12393179, ECO:0000269|PubMed:15241014}.

Sequence

MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLAD
MRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPT
PEASGGSLEIDFQVVQSSSFGGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDER
ESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRL
KRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR
HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDA
SHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE
VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSE
NPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYG
NNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD
RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSED
VWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG

Sequence length

693

Interactions

View interactions

	Reactome
			XBP1(S) activates chaperone genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Inhibit	28169398	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	21829568	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Associate	26059843	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	23104009	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gonadoblastoma	Associate	28169398	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	24291816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Associate	11395479	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21829568, 25119594	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	28169398, 36918555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	28169398	★★★★★ ★☆☆☆☆ Found in Text Mining only

TSPYL2 (TSPY like 2)