SELPLG (selectin P ligand)

Gene

• Entrez ID: 6404
• Gene name: Selectin P ligand
• Gene symbol: SELPLG
• Synonyms (NCBI Gene): CD162, CLA, PSGL-1, PSGL1
• Chromosome: 12
• Chromosome location: 12q24.11
• Summary: This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte tr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017394	hsa-miR-335-5p	Microarray	18185580
MIRT637088	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT637087	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT637086	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT637085	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT637084	hsa-miR-612	HITS-CLIP	23824327
MIRT637083	hsa-miR-6860	HITS-CLIP	23824327
MIRT637082	hsa-miR-4486	HITS-CLIP	23824327
MIRT637081	hsa-miR-378g	HITS-CLIP	23824327
MIRT637080	hsa-miR-4284	HITS-CLIP	23824327
MIRT637079	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT637078	hsa-miR-6877-5p	HITS-CLIP	23824327
MIRT637077	hsa-miR-6781-5p	HITS-CLIP	23824327
MIRT637076	hsa-miR-1268a	HITS-CLIP	23824327
MIRT637075	hsa-miR-1268b	HITS-CLIP	23824327
MIRT637074	hsa-miR-4314	HITS-CLIP	23824327
MIRT637073	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT618520	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT618519	hsa-miR-4532	HITS-CLIP	23824327
MIRT618518	hsa-miR-1470	HITS-CLIP	23824327
MIRT618517	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT618516	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618515	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT637088	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT637087	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT637086	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT637085	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT637084	hsa-miR-612	HITS-CLIP	23824327
MIRT637083	hsa-miR-6860	HITS-CLIP	23824327
MIRT637082	hsa-miR-4486	HITS-CLIP	23824327
MIRT637081	hsa-miR-378g	HITS-CLIP	23824327
MIRT637080	hsa-miR-4284	HITS-CLIP	23824327
MIRT637079	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT637078	hsa-miR-6877-5p	HITS-CLIP	23824327
MIRT637077	hsa-miR-6781-5p	HITS-CLIP	23824327
MIRT637076	hsa-miR-1268a	HITS-CLIP	23824327
MIRT637075	hsa-miR-1268b	HITS-CLIP	23824327
MIRT637074	hsa-miR-4314	HITS-CLIP	23824327
MIRT637073	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT618520	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT618519	hsa-miR-4532	HITS-CLIP	23824327
MIRT618518	hsa-miR-1470	HITS-CLIP	23824327
MIRT618517	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT618516	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618515	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT1334342	hsa-miR-185	CLIP-seq
MIRT1334343	hsa-miR-3123	CLIP-seq
MIRT1334344	hsa-miR-3126-5p	CLIP-seq
MIRT1334345	hsa-miR-3148	CLIP-seq
MIRT1334346	hsa-miR-3190	CLIP-seq
MIRT1334347	hsa-miR-4306	CLIP-seq
MIRT1334348	hsa-miR-4419a	CLIP-seq
MIRT1334349	hsa-miR-4428	CLIP-seq
MIRT1334350	hsa-miR-4434	CLIP-seq
MIRT1334351	hsa-miR-4497	CLIP-seq
MIRT1334352	hsa-miR-4510	CLIP-seq
MIRT1334353	hsa-miR-4516	CLIP-seq
MIRT1334354	hsa-miR-4531	CLIP-seq
MIRT1334355	hsa-miR-4534	CLIP-seq
MIRT1334356	hsa-miR-4644	CLIP-seq
MIRT1334357	hsa-miR-4793-3p	CLIP-seq
MIRT1334358	hsa-miR-671-5p	CLIP-seq
MIRT1334359	hsa-miR-1343	CLIP-seq
MIRT1334360	hsa-miR-3074-5p	CLIP-seq
MIRT2323740	hsa-miR-3929	CLIP-seq
MIRT2323741	hsa-miR-4419b	CLIP-seq
MIRT2323742	hsa-miR-4438	CLIP-seq
MIRT2323743	hsa-miR-4478	CLIP-seq
MIRT2323744	hsa-miR-4687-5p	CLIP-seq
MIRT2323745	hsa-miR-513a-5p	CLIP-seq
MIRT2690348	hsa-miR-1252	CLIP-seq
MIRT1334349	hsa-miR-4428	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001931	Component	Uropod	IDA	21696602
GO:0005102	Function	Signaling receptor binding	NAS	7505206
GO:0005515	Function	Protein binding	IPI	11081633, 18196517, 19118202, 26627825, 28011641
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21696602
GO:0005886	Component	Plasma membrane	TAS	7505206
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	7505206
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7505206, 7541799
GO:0044853	Component	Plasma membrane raft	IDA	25425738
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050900	Process	Leukocyte migration	IDA	25425738
GO:0050901	Process	Leukocyte tethering or rolling	IBA
GO:0050901	Process	Leukocyte tethering or rolling	IDA	25425738
GO:0050902	Process	Leukocyte adhesive activation	ISS
GO:0071354	Process	Cellular response to interleukin-6	IDA	9486531

Other IDs

• MIM: 600738
• HGNC: 10722
• e!Ensembl: ENSG00000110876

Protein

• UniProt ID: Q14242
• Protein name: P-selectin glycoprotein ligand 1 (PSGL-1) (Selectin P ligand) (CD antigen CD162)
• Protein function: A SLe(x)-type proteoglycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. Critical for the initial l
• PDB: 1G1S
• Tissue specificity: TISSUE SPECIFICITY: Expressed on neutrophils, monocytes and most lymphocytes.
• Sequence:

  MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
  EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
  IQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATE
  AQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATE
  AQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
  SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
  EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP

• Sequence length: 412

Pathways

KEGG:

Cell adhesion molecules
Neutrophil extracellular trap formation
Staphylococcus aureus infection

Reactome:

Cell surface interactions at the vascular wall

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELPLG-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acute Coronary Syndrome	Associate	29962384	★☆☆☆☆ Found in Text Mining only
Acute Disease	Associate	20577222	★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Associate	12125957	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	33773368	★☆☆☆☆ Found in Text Mining only
Anthropophobia	Inhibit	34831335	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Associate	17545190, 36044595	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Associate	11310827	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	24288552, 35628558	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	17420019, 19395438, 39198660	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Associate	22022418	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	35425695	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Stimulate	22535539	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	17420019, 18182036, 39198660	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	17420019	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Associate	11843835	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	22488927	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	11169447, 18234849	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	17420019	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	37224922	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	25993480	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	10931129, 18007580, 25510765, 33093567	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Stimulate	35743310	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Associate	17073944	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	27381673, 39198660	★☆☆☆☆ Found in Text Mining only
Enterovirus Infections	Associate	21079683, 37078358	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Inhibit	26881265	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Associate	12139736	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Inhibit	22885125	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	31442594	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Associate	35774790	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Associate	25903419	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Associate	23504637	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Associate	27764137	★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	37854605	★☆☆☆☆ Found in Text Mining only
Infections	Inhibit	23834268, 32193343	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	14507929, 16232226, 17420019, 18182036, 19395438, 22488927, 33093567, 9028320	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	32273392	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	23039882	★☆☆☆☆ Found in Text Mining only
Leprosy	Associate	17343614	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Stimulate	37168856	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	7540063	★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Associate	11843824	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Associate	29689251	★☆☆☆☆ Found in Text Mining only
Lung Injury	Associate	29425463, 36922030	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	22535539, 32549766	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	24288552	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	16691194	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	35784355	★☆☆☆☆ Found in Text Mining only
Lymphoma Large Cell Anaplastic	Associate	40267632	★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	17827388	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Associate	12485447, 35850209	★☆☆☆☆ Found in Text Mining only
Machado Joseph Disease	Associate	25914309	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	35774790, 37115668, 9166933	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	35294519, 38243063	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	39198660	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	23873187	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35153625, 35710862, 35774790, 37115668, 37854605, 39198660	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	40165145	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Occlusive Disease 1	Associate	27991581	★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	25838267, 29425463	★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Associate	36922030	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11843824	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	18647941	★☆☆☆☆ Found in Text Mining only
Psoriasis	Stimulate	23750651	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	16232226	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	23834268	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	29425463	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Associate	40628996	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Associate	29689251	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Stimulate	29689251	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Associate	17546636	★☆☆☆☆ Found in Text Mining only
Sinusitis	Associate	27128095	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Inhibit	22885125	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Associate	9166933	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Associate	31897593, 37854605	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	17420019	★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	17545190, 36044595	★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Associate	9028320	★☆☆☆☆ Found in Text Mining only