SELPLG (selectin P ligand)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6404
Gene name Gene Name - the full gene name approved by the HGNC.
Selectin P ligand
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SELPLG
Synonyms (NCBI Gene) Gene synonyms aliases
CD162, CLA, PSGL-1, PSGL1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte tr
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(72)
miRTarBase ID miRNA Experiments Reference
MIRT017394 hsa-miR-335-5p Microarray 18185580
MIRT637088 hsa-miR-342-3p HITS-CLIP 23824327
MIRT637087 hsa-miR-1285-3p HITS-CLIP 23824327
MIRT637086 hsa-miR-3187-5p HITS-CLIP 23824327
MIRT637085 hsa-miR-5189-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0001931 Component Uropod IDA 21696602
GO:0005102 Function Signaling receptor binding NAS 7505206
GO:0005515 Function Protein binding IPI 11081633, 18196517, 19118202, 26627825, 28011641
GO:0005886 Component Plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600738 10722 ENSG00000110876
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q14242
Protein name P-selectin glycoprotein ligand 1 (PSGL-1) (Selectin P ligand) (CD antigen CD162)
Protein function A SLe(x)-type proteoglycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. Critical for the initial l
PDB 1G1S
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed on neutrophils, monocytes and most lymphocytes.
Sequence 
MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
IQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATE
AQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATE
AQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
Sequence length 412
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules
Neutrophil extracellular trap formation
Staphylococcus aureus infection 		  Cell surface interactions at the vascular wall
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Familial rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 11796754
Lateral sclerosis AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048 11796754
Show/Hide Text Mining Associations (78)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 29962384
Acute Disease Associate 20577222
Alopecia Areata Associate 12125957
Alzheimer Disease Associate 33773368
Anthropophobia Inhibit 34831335
Antiphospholipid Syndrome Associate 17545190, 36044595
Arthritis Psoriatic Associate 11310827
Arthritis Rheumatoid Associate 24288552, 35628558
Atherosclerosis Associate 17420019, 19395438, 39198660
Blood Platelet Disorders Associate 22022418