Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	63978
Gene name Gene Name - the full gene name approved by the HGNC.	PR/SET domain 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRDM14
Synonyms (NCBI Gene) Gene synonyms aliases	PFM11
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments
MIRT1259994	hsa-miR-1227	CLIP-seq
MIRT1259995	hsa-miR-3149	CLIP-seq
MIRT1259996	hsa-miR-361-3p	CLIP-seq
MIRT1259997	hsa-miR-455-5p	CLIP-seq
MIRT1259998	hsa-miR-4715-3p	CLIP-seq
MIRT2076579	hsa-miR-4726-3p	CLIP-seq
MIRT2303183	hsa-miR-106a	CLIP-seq
MIRT2303184	hsa-miR-106b	CLIP-seq
MIRT2303185	hsa-miR-150	CLIP-seq
MIRT2303186	hsa-miR-17	CLIP-seq
MIRT2303187	hsa-miR-20a	CLIP-seq
MIRT2303188	hsa-miR-20b	CLIP-seq
MIRT2303189	hsa-miR-302a	CLIP-seq
MIRT2303190	hsa-miR-302b	CLIP-seq
MIRT2303191	hsa-miR-302c	CLIP-seq
MIRT2303192	hsa-miR-302d	CLIP-seq
MIRT2303193	hsa-miR-302e	CLIP-seq
MIRT2303194	hsa-miR-372	CLIP-seq
MIRT2303195	hsa-miR-373	CLIP-seq
MIRT2303196	hsa-miR-4438	CLIP-seq
MIRT2303197	hsa-miR-4731-5p	CLIP-seq
MIRT2303198	hsa-miR-5095	CLIP-seq
MIRT2303199	hsa-miR-512-3p	CLIP-seq
MIRT2303200	hsa-miR-519d	CLIP-seq
MIRT2303201	hsa-miR-520a-3p	CLIP-seq
MIRT2303202	hsa-miR-520b	CLIP-seq
MIRT2303203	hsa-miR-520c-3p	CLIP-seq
MIRT2303204	hsa-miR-520d-3p	CLIP-seq
MIRT2303205	hsa-miR-520e	CLIP-seq
MIRT2303206	hsa-miR-520g	CLIP-seq
MIRT2303207	hsa-miR-520h	CLIP-seq
MIRT2303208	hsa-miR-93	CLIP-seq
MIRT1259995	hsa-miR-3149	CLIP-seq
MIRT1259996	hsa-miR-361-3p	CLIP-seq
MIRT1259998	hsa-miR-4715-3p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0001708	Process	Cell fate specification	IEA
GO:0001827	Process	Inner cell mass cell fate commitment	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 23088713, 24722188, 25416956, 25910212, 26871637, 27281218, 28514442, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007281	Process	Germ cell development	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0009566	Process	Fertilization	IEA
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0030718	Process	Germ-line stem cell population maintenance	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0034972	Process	Histone H3-R26 methylation	IBA	21873635
GO:0035019	Process	Somatic stem cell population maintenance	TAS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0044030	Process	Regulation of DNA methylation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0060817	Process	Inactivation of paternal X chromosome	IEA
GO:1902093	Process	Positive regulation of flagellated sperm motility	IEA
GO:1902459	Process	Positive regulation of stem cell population maintenance	IEA

MIM	HGNC	e!Ensembl
611781	14001	ENSG00000147596

Protein

UniProt ID

Q9GZV8

Protein name

PR domain zinc finger protein 14 (EC 2.1.1.-) (PR domain-containing protein 14)

Protein function

Transcription factor that has both positive and negative roles on transcription. Required for the maintenance of embryonic stem cell identity and the reacquisition of pluripotency in somatic cells. May play an essential role in germ cell develop

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	461 → 483	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	489 → 511	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	546 → 568	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in embryonic stem cells. Tends to be overexpressed in breast cancer (at protein level). {ECO:0000269|PubMed:17942894, ECO:0000269|PubMed:20953172}.

Sequence

MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAA
SAAPAMPPFPFRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHE
YAGASSEDLGHQIIGGDNESGPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSED
GPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQ
TLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRFGPFQGKVVNASEVKTYGDNS
VMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFYESCKEIHQNQ
ELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLK
YTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHM
RVHSGDRPYQCVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSH
KEDDGCSCSICGKIFSDQETFYSHMKFHEDY

Sequence length

571

Interactions

View interactions

	Reactome
			Transcriptional regulation of pluripotent stem cells

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Lymphoblastic leukemia	Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	19043588
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	30285260, 28991256

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Stimulate	33355367
Breast Neoplasms	Associate	20473280, 29178343, 33499882
Carcinoma Embryonal	Associate	29324254
Carcinoma Non Small Cell Lung	Associate	25635434
Carcinoma Renal Cell	Associate	33629299
Colorectal Neoplasms	Associate	30658502, 35065650
Endodermal Sinus Tumor	Associate	29324254
Germinoma	Associate	29324254
Granulosa cell tumor of the ovary	Associate	29324254
Neoplasms	Associate	26929985, 33355367
Neoplasms	Stimulate	29178343
Neoplasms Germ Cell and Embryonal	Associate	29324254
Non Muscle Invasive Bladder Neoplasms	Associate	26929985
Schizophrenia	Associate	28117656
Seminoma	Associate	29324254
Triple Negative Breast Neoplasms	Associate	29178343
Urinary Bladder Neoplasms	Associate	35123558

PRDM14 (PR/SET domain 14)