NEUROD6 (neuronal differentiation 6)

Gene

• Entrez ID: 63974
• Gene name: Neuronal differentiation 6
• Gene symbol: NEUROD6
• Synonyms (NCBI Gene): Atoh2, MATH2, Math-2, NEX1M, Nex1, bHLHa2
• Chromosome: 7
• Chromosome location: 7p14.3
• Summary: This gene is a member of the NEUROD family of basic helix-loop-helix transcription factors. The encoded protein may be involved in the development and differentiation of the nervous system. [provided by RefSeq, Nov 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2281867	hsa-miR-374a	CLIP-seq
MIRT2281868	hsa-miR-374b	CLIP-seq
MIRT2281869	hsa-miR-586	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007423	Process	Sensory organ development	IBA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0061564	Process	Axon development	IBA
GO:0070888	Function	E-box binding	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 611513
• HGNC: 13804
• e!Ensembl: ENSG00000164600

Protein

• UniProt ID: Q96NK8
• Protein name: Neurogenic differentiation factor 6 (NeuroD6) (Class A basic helix-loop-helix protein 2) (bHLHa2) (Protein atonal homolog 2)
• Protein function: Activates E box-dependent transcription in collaboration with TCF3/E47. May be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. Transactivates the promoter of its own gene (By similarity). {ECO:0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	95 → 147	Helix-loop-helix DNA-binding domain	Domain
  PF12533	Neuro_bHLH	153 → 272	Neuronal helix-loop-helix transcription factor	Family

• Sequence:

  MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEE
  EEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKV
  VPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGC
  LQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAY
  ESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPL
  GQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN

• Sequence length: 337