DUSP21 (dual specificity phosphatase 21)

Gene

• Entrez ID: 63904
• Gene name: Dual specificity phosphatase 21
• Gene symbol: DUSP21
• Synonyms (NCBI Gene): LMWDSP21
• Chromosome: X
• Chromosome location: Xp11.3
• Summary: This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029371	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	12408986
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	12408986
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12408986
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	12408986
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	ISS

Other IDs

• MIM: 300678
• HGNC: 20476
• e!Ensembl: ENSG00000189037

Protein

• UniProt ID: Q9H596
• Protein name: Dual specificity protein phosphatase 21 (EC 3.1.3.16) (EC 3.1.3.48) (Low molecular weight dual specificity phosphatase 21) (LMW-DSP21)
• Protein function: Protein phosphatase component of the sperm flagellar doublet microtubules (By similarity). May act as a regulator of sperm motility by mediating dephosphorylation of sperm doublet microtubule proteins (By similarity). Can dephosphorylate single
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00782	DSPc	29 → 159	Dual specificity phosphatase, catalytic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:12408986}.
• Sequence:

  MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVN
  VFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAY
  LMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIY
  EKDLRMMISM

• Sequence length: 190