Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6373
Gene name Gene Name - the full gene name approved by the HGNC.	C-X-C motif chemokine ligand 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CXCL11
Synonyms (NCBI Gene) Gene synonyms aliases	H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chem

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT530625	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT530624	hsa-miR-548b-3p	PAR-CLIP	22012620
MIRT530623	hsa-miR-4511	PAR-CLIP	22012620
MIRT530622	hsa-miR-30a-5p	PAR-CLIP	22012620
MIRT530621	hsa-miR-30b-5p	PAR-CLIP	22012620
MIRT530620	hsa-miR-30c-5p	PAR-CLIP	22012620
MIRT530619	hsa-miR-30d-5p	PAR-CLIP	22012620
MIRT530618	hsa-miR-30e-5p	PAR-CLIP	22012620
MIRT732534	hsa-miR-1298-5p	Luciferase reporter assay, Western blotting	33469358
MIRT734915	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	33229509
MIRT736400	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT736413	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT530625	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT530624	hsa-miR-548b-3p	PAR-CLIP	22012620
MIRT530623	hsa-miR-4511	PAR-CLIP	22012620
MIRT530622	hsa-miR-30a-5p	PAR-CLIP	22012620
MIRT530621	hsa-miR-30b-5p	PAR-CLIP	22012620
MIRT530620	hsa-miR-30c-5p	PAR-CLIP	22012620
MIRT530619	hsa-miR-30d-5p	PAR-CLIP	22012620
MIRT530618	hsa-miR-30e-5p	PAR-CLIP	22012620
MIRT917658	hsa-miR-101	CLIP-seq
MIRT917659	hsa-miR-144	CLIP-seq
MIRT917660	hsa-miR-3140-3p	CLIP-seq
MIRT917661	hsa-miR-376a	CLIP-seq
MIRT917662	hsa-miR-376b	CLIP-seq
MIRT917663	hsa-miR-4325	CLIP-seq
MIRT917664	hsa-miR-455-5p	CLIP-seq
MIRT917665	hsa-miR-4775	CLIP-seq
MIRT917666	hsa-miR-4776-3p	CLIP-seq
MIRT917667	hsa-miR-513a-3p	CLIP-seq
MIRT917668	hsa-miR-582-5p	CLIP-seq
MIRT917669	hsa-miR-590-3p	CLIP-seq
MIRT1972060	hsa-miR-205	CLIP-seq
MIRT1972061	hsa-miR-23a	CLIP-seq
MIRT1972062	hsa-miR-23b	CLIP-seq
MIRT1972063	hsa-miR-23c	CLIP-seq
MIRT1972064	hsa-miR-4793-5p	CLIP-seq
MIRT1972065	hsa-miR-5096	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 25416956, 27044744, 28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IDA	12782716
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10233762
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10233762
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	10233762
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12782716
GO:0007267	Process	Cell-cell signaling	TAS	10233762
GO:0008009	Function	Chemokine activity	IDA	12782716
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10233762
GO:0008201	Function	Heparin binding	IMP	18645041
GO:0010818	Process	T cell chemotaxis	IMP	18645041
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0042127	Process	Regulation of cell population proliferation	IMP	12782716
GO:0048248	Function	CXCR3 chemokine receptor binding	IDA	12782716
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	12782716
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IMP	18645041

MIM	HGNC	e!Ensembl
604852	10638	ENSG00000169248

Protein

UniProt ID

O14625

Protein name

C-X-C motif chemokine 11 (Beta-R1) (H174) (Interferon gamma-inducible protein 9) (IP-9) (Interferon-inducible T-cell alpha chemoattractant) (I-TAC) (Small-inducible cytokine B11)

Protein function

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May

PDB

1RJT , 8HNK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	28 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin diso

Sequence

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Toll-like receptor signaling pathway		Chemokine receptors bind chemokines G alpha (i) signalling events

CXCL11 (C-X-C motif chemokine ligand 11)