Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6372
Gene name Gene Name - the full gene name approved by the HGNC.
C-X-C motif chemokine ligand 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CXCL6
Synonyms (NCBI Gene) Gene synonyms aliases
CKA-3, GCP-2, GCP2, SCYB6
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029714 hsa-miR-26b-5p Microarray 19088304
MIRT650703 hsa-miR-140-3p HITS-CLIP 23824327
MIRT650702 hsa-miR-4798-5p HITS-CLIP 23824327
MIRT650703 hsa-miR-140-3p HITS-CLIP 23824327
MIRT650702 hsa-miR-4798-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001776 Process Leukocyte homeostasis IEA
GO:0005515 Function Protein binding IPI 28381538
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0006935 Process Chemotaxis TAS 9164944
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
138965 10643 ENSG00000124875
Protein
UniProt ID P80162
Protein name C-X-C motif chemokine 6 (Chemokine alpha 3) (CKA-3) (Granulocyte chemotactic protein 2) (GCP-2) (Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6, N-processed variant 1; Small-inducible cytokine B6, N-processed variant 2; Small-indu
Protein function Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-neg
PDB 8XWM , 8XXX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 47 106 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKI
LDSGNKKN
Sequence length 114
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Pertussis
Rheumatoid arthritis
  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 15292528
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 15292528
Associations from Text Mining
Disease Name Relationship Type References
Anastomotic Leak Stimulate 35652588
Aortic Valve Stenosis Associate 40008515
Apical Hypertrophic Cardiomyopathy Associate 35328555
Arthritis Juvenile Associate 28012239
Breast Neoplasms Associate 18045955
Carcinoma Hepatocellular Associate 25323032, 36975480
Carcinoma Non Small Cell Lung Associate 34637697
Cheilitis glandularis Stimulate 28285559
Colonic Neoplasms Associate 36246978
Colorectal Neoplasms Associate 28811711, 29850390, 34419055