Gene Gene information from NCBI Gene database.
Entrez ID 6372
Gene name C-X-C motif chemokine ligand 6
Gene symbol CXCL6
Synonyms (NCBI Gene)
CKA-3GCP-2GCP2SCYB6
Chromosome 4
Chromosome location 4q13.3
Summary The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemo
miRNA miRNA information provided by mirtarbase database.
242
miRTarBase ID miRNA Experiments Reference
MIRT029714 hsa-miR-26b-5p Microarray 19088304
MIRT650703 hsa-miR-140-3p HITS-CLIP 23824327
MIRT650702 hsa-miR-4798-5p HITS-CLIP 23824327
MIRT650703 hsa-miR-140-3p HITS-CLIP 23824327
MIRT650702 hsa-miR-4798-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001776 Process Leukocyte homeostasis IEA
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 28381538
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
138965 10643 ENSG00000124875
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P80162
Protein name C-X-C motif chemokine 6 (Chemokine alpha 3) (CKA-3) (Granulocyte chemotactic protein 2) (GCP-2) (Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6, N-processed variant 1; Small-inducible cytokine B6, N-processed variant 2; Small-indu
Protein function Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-neg
PDB 8XWM , 8XXX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 47 106 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKI
LDSGNKKN
Sequence length 114
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Pertussis
Rheumatoid arthritis
  Chemokine receptors bind chemokines
G alpha (i) signalling events