Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6352
Gene name	C-C motif chemokine ligand 5
Gene symbol	CCL5
Synonyms (NCBI Gene)	D17S136ERANTESSCYA5SIS-deltaSISdTCP228eoCP
Chromosome	17
Chromosome location	17q12
Summary	This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the

417

Show/Hide all (417)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005677	hsa-miR-98-5p	ELISA	20589685
MIRT005678	hsa-miR-125a-5p	ELISA	20589685
MIRT053786	hsa-miR-214-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCR	23171795
MIRT437504	hsa-miR-146a-5p	Luciferase reporter assay	24996260
MIRT685370	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685369	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685368	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685367	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685366	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685365	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685364	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685363	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685362	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685361	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685360	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685359	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685358	hsa-miR-302e	HITS-CLIP	23313552
MIRT685357	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685356	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685355	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685354	hsa-miR-520b	HITS-CLIP	23313552
MIRT685353	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685352	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685351	hsa-miR-520e	HITS-CLIP	23313552
MIRT518354	hsa-miR-4438	HITS-CLIP	23313552
MIRT685350	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT518353	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT685349	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685348	hsa-miR-520h	HITS-CLIP	23313552
MIRT685347	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT685346	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT518351	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT518350	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685345	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685344	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT518344	hsa-miR-5095	HITS-CLIP	23313552
MIRT518343	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT685343	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT685342	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT685341	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT518342	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT518355	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT518354	hsa-miR-4438	PAR-CLIP	23446348
MIRT518353	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT518352	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT518351	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT518350	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT518349	hsa-miR-6853-5p	PAR-CLIP	23446348
MIRT518348	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT518347	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT518346	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT518345	hsa-miR-4775	PAR-CLIP	23446348
MIRT518344	hsa-miR-5095	PAR-CLIP	23446348
MIRT518343	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT518342	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT005677	hsa-miR-98-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	26126865
MIRT733067	hsa-miR-147a	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	31884861
MIRT736398	hsa-miR-369-3p	qRT-PCRFlow cytometry	33679688
MIRT736407	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT685370	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685369	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685368	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685367	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685366	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685365	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685364	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685363	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685362	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685361	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685360	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685359	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685358	hsa-miR-302e	HITS-CLIP	23313552
MIRT685357	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685356	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685355	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685354	hsa-miR-520b	HITS-CLIP	23313552
MIRT685353	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685352	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685351	hsa-miR-520e	HITS-CLIP	23313552
MIRT518354	hsa-miR-4438	HITS-CLIP	23313552
MIRT685350	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT518353	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT685349	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685348	hsa-miR-520h	HITS-CLIP	23313552
MIRT685347	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT685346	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT518351	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT518350	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685345	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685344	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT518344	hsa-miR-5095	HITS-CLIP	23313552
MIRT518343	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT685343	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT685342	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT685341	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT518342	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT518355	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT518354	hsa-miR-4438	PAR-CLIP	23446348
MIRT518353	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT518352	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT518351	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT518350	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT518349	hsa-miR-6853-5p	PAR-CLIP	23446348
MIRT518348	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT518347	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT518346	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT518345	hsa-miR-4775	PAR-CLIP	23446348
MIRT518344	hsa-miR-5095	PAR-CLIP	23446348
MIRT518343	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT518342	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT755398	hsa-miR-6499-3p	Luciferase reporter assayWestern blottingqRT-PCR	34697152
MIRT755534	hsa-miR-149-5p	qRT-PCR	36250208
MIRT871061	hsa-miR-106a	CLIP-seq
MIRT871062	hsa-miR-106b	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT871066	hsa-miR-1245	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871070	hsa-miR-1343	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871072	hsa-miR-150	CLIP-seq
MIRT871073	hsa-miR-17	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871075	hsa-miR-20a	CLIP-seq
MIRT871076	hsa-miR-20b	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871078	hsa-miR-302a	CLIP-seq
MIRT871079	hsa-miR-302b	CLIP-seq
MIRT871080	hsa-miR-302c	CLIP-seq
MIRT871081	hsa-miR-302d	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT871084	hsa-miR-3616-5p	CLIP-seq
MIRT871085	hsa-miR-3647-5p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT871087	hsa-miR-3663-5p	CLIP-seq
MIRT871088	hsa-miR-3667-3p	CLIP-seq
MIRT871089	hsa-miR-3672	CLIP-seq
MIRT871090	hsa-miR-372	CLIP-seq
MIRT871091	hsa-miR-373	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871101	hsa-miR-4728-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT871103	hsa-miR-4757-5p	CLIP-seq
MIRT871104	hsa-miR-4795-5p	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT871107	hsa-miR-518d-5p	CLIP-seq
MIRT871108	hsa-miR-519b-5p	CLIP-seq
MIRT871109	hsa-miR-519c-5p	CLIP-seq
MIRT871110	hsa-miR-519d	CLIP-seq
MIRT871111	hsa-miR-520c-5p	CLIP-seq
MIRT871112	hsa-miR-520g	CLIP-seq
MIRT871113	hsa-miR-526a	CLIP-seq
MIRT871114	hsa-miR-573	CLIP-seq
MIRT871115	hsa-miR-617	CLIP-seq
MIRT871116	hsa-miR-628-5p	CLIP-seq
MIRT871117	hsa-miR-640	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871119	hsa-miR-93	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT871066	hsa-miR-1245	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT1958650	hsa-miR-3187-3p	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT871084	hsa-miR-3616-5p	CLIP-seq
MIRT871085	hsa-miR-3647-5p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT871087	hsa-miR-3663-5p	CLIP-seq
MIRT871089	hsa-miR-3672	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT1958651	hsa-miR-4435	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT1958652	hsa-miR-4701-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT1958653	hsa-miR-4755-3p	CLIP-seq
MIRT1958654	hsa-miR-4781-3p	CLIP-seq
MIRT871104	hsa-miR-4795-5p	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT1958655	hsa-miR-548s	CLIP-seq
MIRT871114	hsa-miR-573	CLIP-seq
MIRT1958656	hsa-miR-588	CLIP-seq
MIRT871115	hsa-miR-617	CLIP-seq
MIRT871117	hsa-miR-640	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT1958650	hsa-miR-3187-3p	CLIP-seq
MIRT871084	hsa-miR-3616-5p	CLIP-seq
MIRT871085	hsa-miR-3647-5p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT871087	hsa-miR-3663-5p	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT1958651	hsa-miR-4435	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT1958652	hsa-miR-4701-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT1958653	hsa-miR-4755-3p	CLIP-seq
MIRT1958654	hsa-miR-4781-3p	CLIP-seq
MIRT871104	hsa-miR-4795-5p	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT1958655	hsa-miR-548s	CLIP-seq
MIRT871114	hsa-miR-573	CLIP-seq
MIRT1958656	hsa-miR-588	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT2385693	hsa-miR-2110	CLIP-seq
MIRT2385694	hsa-miR-4271	CLIP-seq
MIRT2385695	hsa-miR-4667-5p	CLIP-seq
MIRT2385696	hsa-miR-4700-5p	CLIP-seq
MIRT2385697	hsa-miR-4725-3p	CLIP-seq
MIRT2385698	hsa-miR-4747-5p	CLIP-seq
MIRT2385699	hsa-miR-661	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871061	hsa-miR-106a	CLIP-seq
MIRT871062	hsa-miR-106b	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT2498646	hsa-miR-1285	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871070	hsa-miR-1343	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT2498647	hsa-miR-147	CLIP-seq
MIRT871072	hsa-miR-150	CLIP-seq
MIRT871073	hsa-miR-17	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871075	hsa-miR-20a	CLIP-seq
MIRT871076	hsa-miR-20b	CLIP-seq
MIRT2385693	hsa-miR-2110	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT2498648	hsa-miR-296-5p	CLIP-seq
MIRT871078	hsa-miR-302a	CLIP-seq
MIRT871079	hsa-miR-302b	CLIP-seq
MIRT871080	hsa-miR-302c	CLIP-seq
MIRT871081	hsa-miR-302d	CLIP-seq
MIRT2498649	hsa-miR-3074-5p	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2498650	hsa-miR-3150a-3p	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT2498651	hsa-miR-3174	CLIP-seq
MIRT2498652	hsa-miR-3187-5p	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT2498653	hsa-miR-330-3p	CLIP-seq
MIRT2498654	hsa-miR-3529	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2498655	hsa-miR-3656	CLIP-seq
MIRT871090	hsa-miR-372	CLIP-seq
MIRT871091	hsa-miR-373	CLIP-seq
MIRT2498656	hsa-miR-378g	CLIP-seq
MIRT2498657	hsa-miR-379	CLIP-seq
MIRT2498658	hsa-miR-3911	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT2498659	hsa-miR-4259	CLIP-seq
MIRT2385694	hsa-miR-4271	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT2498660	hsa-miR-4451	CLIP-seq
MIRT2498661	hsa-miR-4486	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT2498662	hsa-miR-4536	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT2498663	hsa-miR-4650-3p	CLIP-seq
MIRT2385695	hsa-miR-4667-5p	CLIP-seq
MIRT2385696	hsa-miR-4700-5p	CLIP-seq
MIRT2498664	hsa-miR-4715-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT2385697	hsa-miR-4725-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT2385698	hsa-miR-4747-5p	CLIP-seq
MIRT871103	hsa-miR-4757-5p	CLIP-seq
MIRT2498665	hsa-miR-503	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT871110	hsa-miR-519d	CLIP-seq
MIRT871112	hsa-miR-520g	CLIP-seq
MIRT2498666	hsa-miR-612	CLIP-seq
MIRT2498667	hsa-miR-644	CLIP-seq
MIRT2498668	hsa-miR-645	CLIP-seq
MIRT2385699	hsa-miR-661	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT2498669	hsa-miR-921	CLIP-seq
MIRT871119	hsa-miR-93	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT871066	hsa-miR-1245	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871070	hsa-miR-1343	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT2385693	hsa-miR-2110	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2498650	hsa-miR-3150a-3p	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT2498653	hsa-miR-330-3p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT2498659	hsa-miR-4259	CLIP-seq
MIRT2385694	hsa-miR-4271	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT2498664	hsa-miR-4715-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT2385697	hsa-miR-4725-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT871103	hsa-miR-4757-5p	CLIP-seq
MIRT2498665	hsa-miR-503	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT871117	hsa-miR-640	CLIP-seq
MIRT2498668	hsa-miR-645	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq

Show/Hide all (16)

Transcription factor	Regulation	Reference
ATF3	Unknown	10760799
CREB1	Unknown	11413310
IRF1	Unknown	10385645
IRF3	Unknown	10385645;20483755
IRF7	Unknown	10385645
JUN	Unknown	11413310
JUND	Unknown	10760799
KLF13	Unknown	17513757;22797700
NFKB1	Activation	11478739;9120310
NFKB1	Unknown	11259372;11389171;11413310;12122011;19786024
NFKBIA	Repression	15228586
REL	Unknown	11259372
RELA	Activation	11478739;9120310
RELA	Unknown	11259372;11389171;11413310;12122011;19786024
SP1	Unknown	11259372
SPI1	Unknown	10760799

104

Show/Hide all (104)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	TAS	18337562
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0002676	Process	Regulation of chronic inflammatory response	TAS	10488085
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IDA	10734056
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	8699119, 23480650, 28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	29772059
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	NAS	1380064
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	8558019
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17001303, 23979485
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007267	Process	Cell-cell signaling	IDA	8558019
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	1699135, 9417081, 29772059
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	NAS	7524281
GO:0009615	Process	Response to virus	TAS	10488085
GO:0009636	Process	Response to toxic substance	IDA	10841574
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IDA	16778803
GO:0010820	Process	Positive regulation of T cell chemotaxis	IDA	1699135, 7544376, 16778803, 18337562
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IDA	21297082
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IDA	10488085
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673
GO:0031583	Process	Phospholipase D-activating G protein-coupled receptor signaling pathway	IDA	9469451
GO:0031726	Function	CCR1 chemokine receptor binding	IDA	10910894
GO:0031726	Function	CCR1 chemokine receptor binding	IEA
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 8699119, 10660125, 10734056
GO:0031726	Function	CCR1 chemokine receptor binding	TAS	9417081
GO:0031729	Function	CCR4 chemokine receptor binding	TAS	9417081
GO:0031730	Function	CCR5 chemokine receptor binding	IPI	9139699
GO:0032008	Process	Positive regulation of TOR signaling	IDA	18337562
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	IDA	8558019
GO:0034097	Process	Response to cytokine	IEA
GO:0034112	Process	Positive regulation of homotypic cell-cell adhesion	IDA	10488085
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0035689	Process	Chemokine (C-C motif) ligand 5 signaling pathway	IDA	9417081
GO:0042056	Function	Chemoattractant activity	IDA	15001559
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	18832695
GO:0042119	Process	Neutrophil activation	IDA	10488085
GO:0042379	Function	Chemokine receptor binding	IPI	7517217, 9139699
GO:0042802	Function	Identical protein binding	IPI	15530372, 21827949, 23480650, 28381538
GO:0042803	Function	Protein homodimerization activity	IPI	10488085
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	10841574
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEP	9407497
GO:0045070	Process	Positive regulation of viral genome replication	TAS	10488085
GO:0045071	Process	Negative regulation of viral genome replication	IDA	10490959
GO:0045089	Process	Positive regulation of innate immune response	TAS	21148810
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	10734056
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	17001303
GO:0045785	Process	Positive regulation of cell adhesion	IDA	10910894
GO:0045948	Process	Positive regulation of translational initiation	NAS	18337562
GO:0046817	Function	Chemokine receptor antagonist activity	IDA	8631850
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	16778803
GO:0048246	Process	Macrophage chemotaxis	TAS	18337562
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21297082
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050796	Process	Regulation of insulin secretion	IDA	23979485
GO:0050863	Process	Regulation of T cell activation	IDA	10488085
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7544376
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	8699119
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	23276697
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	17001303, 23276697
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	TAS	18337562
GO:0070100	Process	Negative regulation of chemokine-mediated signaling pathway	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IDA	10488085
GO:0070234	Process	Positive regulation of T cell apoptotic process	IDA	10488085
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16314496
GO:0071346	Process	Cellular response to type II interferon	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	1699135, 19779041
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	TAS	11278738
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0150078	Process	Positive regulation of neuroinflammatory response	IDA	24854121
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	9417081
GO:2000110	Process	Negative regulation of macrophage apoptotic process	IEA
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

MIM	HGNC	e!Ensembl
187011	10632	ENSG00000271503

P13501

Protein name

C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68); RANTES(4-68)]

Protein function

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major

PDB

1B3A , 1EQT , 1HRJ , 1RTN , 1RTO , 1U4L , 1U4M , 1U4P , 1U4R , 2L9H , 2VXW , 5CMD , 5COY , 5DNF , 5L2U , 5UIW , 6AEZ , 6C6D , 6FGP , 6LOG , 6STK , 7F1R , 7O7F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the follicular fluid (at protein level). T-cell and macrophage specific. {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2456327}.

Sequence

MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Toll-like receptor signaling pathway NOD-like receptor signaling pathway Cytosolic DNA-sensing pathway TNF signaling pathway Prion disease Epithelial cell signaling in Helicobacter pylori infection Shigellosis Chagas disease Human cytomegalovirus infection Influenza A Herpes simplex virus 1 infection Rheumatoid arthritis Lipid and atherosclerosis		Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Human immunodeficiency virus type 1, rapid disease progression with infection by	Pathogenic	rs2280789	RCV000013577

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CCL5-related condition	Likely benign	rs2280788	RCV005357122
Human immunodeficiency virus type 1, delayed disease progression with infection by	Likely benign	rs2280788	RCV000013576

Show/Hide Text Mining Associations (419)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	12114533, 18391751, 20531015, 29641325, 8570619, 8986820
Acro Osteolysis	Associate	29480835
Acute On Chronic Liver Failure	Associate	36626090, 37816833
Addison Disease	Stimulate	29498364
Addison Disease	Associate	29498364
Adenocarcinoma	Associate	27513329
Adenocarcinoma of Lung	Associate	17207890, 17653092, 27513329, 31221150, 32549766, 35240266
Adenoma	Associate	21249124
Adenomatous Polyposis Coli	Associate	38073344
adult multisystem inflammatory disease COVID 19 related	Associate	36102684
Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells	Stimulate	19729668
Alcoholism	Stimulate	26781212
Allergic Fungal Sinusitis	Stimulate	16686375
Allergic Fungal Sinusitis	Associate	26047816, 28095898
Alopecia Areata	Associate	20546884, 27094591
Alzheimer Disease	Associate	19395124, 22272623, 30092003, 34556089
Alzheimer Disease	Inhibit	21942811
Amyotrophic Lateral Sclerosis	Stimulate	29592817
Anemia Sickle Cell	Associate	23900864, 32411797
Aneurysm	Associate	23887838
Angina Unstable	Associate	22664781
Angina Unstable	Stimulate	25424368
Anorexia Nervosa	Stimulate	25022969
Anthracosis	Associate	16524739
Aortic Aneurysm Abdominal	Associate	17321344, 27126477, 34495251
Aortic Aneurysm Abdominal	Stimulate	33858751
Appendicitis	Associate	30918467
Arthritis	Associate	16507178
Arthritis Juvenile	Associate	16507178, 19333930, 20127724
Arthritis Psoriatic	Stimulate	10086850
Arthritis Psoriatic	Associate	16323244, 30181004
Arthritis Rheumatoid	Stimulate	10337033, 16107514
Arthritis Rheumatoid	Associate	12176812, 12588667, 12909630, 15331395, 19740335, 22401175, 26314565, 27411480, 28619088, 31037071, 34484236, 37845777, 39830504, 7521808, 7545093, 7680648 View all (1 more)
Ascites	Associate	33721368
Asthma	Associate	10386610, 12204866, 1380064, 15715189, 16024972, 18178867, 19127215, 20371397, 20523058, 23267209, 24053708, 24641287, 29297467, 35791991, 8977128, 9625753 View all (1 more)
Asthma	Inhibit	40696647
Atherosclerosis	Associate	17622311, 21547257, 34122426, 35795669, 38256102
Autism Spectrum Disorder	Stimulate	35422816
Autoimmune Diseases	Stimulate	10713092
Behcet Syndrome	Associate	23336215
Biliary Atresia	Associate	29070776
Biliary Tract Diseases	Associate	40596471
Bisphosphonate Associated Osteonecrosis of the Jaw	Stimulate	40076479
Blast Injuries	Associate	31621494
Blast Injuries	Stimulate	36508265
Bone Marrow Diseases	Associate	12181060
Brain Injuries	Inhibit	36539847
Brain Injuries Traumatic	Associate	28340601
Breast Neoplasms	Associate	10880401, 17159920, 21486440, 22380870, 23074171, 23370279, 24396281, 24691968, 25171476, 25714853, 25928089, 26173622, 26314842, 29758926, 30808421 View all (8 more)
Breast Neoplasms	Stimulate	33245226
Bronchiolitis	Associate	29253610
Bronchiolitis Obliterans Syndrome	Stimulate	22006860
Bronchiolitis Viral	Associate	29253610
Carcinogenesis	Inhibit	17207890
Carcinoma Adenoid Cystic	Associate	29549020
Carcinoma Basal Cell	Stimulate	31031757
Carcinoma Hepatocellular	Stimulate	15770052
Carcinoma Hepatocellular	Associate	29436633, 31479523, 32730361, 34045534, 36332449, 36513250, 36960063
Carcinoma Hepatocellular	Inhibit	34218795
Carcinoma Intraductal Noninfiltrating	Associate	21486440
Carcinoma Non Small Cell Lung	Associate	23566546, 27513329, 35346313
Carcinoma Pancreatic Ductal	Associate	32923157, 40269781
Carcinoma Renal Cell	Associate	26587829, 32081834, 33173412, 35043231, 35982911, 36854280, 37902279, 39333254
Carcinoma Renal Cell	Stimulate	33177244
Carcinoma Squamous Cell	Associate	37799074
Carotid Artery Diseases	Associate	18060801
Carotid Stenosis	Associate	18060801
Carpal Tunnel Syndrome	Stimulate	34224495
Cartilage Diseases	Associate	11465714
Cataract	Associate	37694725
Cerebral Hemorrhage	Associate	35833818, 36439158
Cerebral Infarction	Associate	39675594
Chagas Cardiomyopathy	Stimulate	23150742
Chemical and Drug Induced Liver Injury	Associate	15770052, 28318046
Cholangiocarcinoma	Associate	35033156
Chronic Kidney Disease Mineral and Bone Disorder	Associate	36799882
Chronic Kidney Diseases of Uncertain Etiology	Associate	19265171
Chronic Periodontitis	Stimulate	21198766
Chronic Periodontitis	Inhibit	26211001
Ciliary Motility Disorders	Associate	29116124
Cognitive Dysfunction	Associate	19395124
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Stimulate	25948880
Colitis Ulcerative	Stimulate	16565224
Colorectal Neoplasms	Associate	16101183, 22593190, 25671296, 29606345, 29872080, 30016783, 30411783, 30554073, 32552875, 34331023, 34539647, 35208526, 35213358, 38212126
Colorectal Neoplasms	Stimulate	35429245
Common Cold	Associate	11576073
Conjunctivitis Allergic	Associate	11090473
Constriction Pathologic	Associate	18060801
Coronary Artery Disease	Inhibit	17504241
Coronary Artery Disease	Associate	17504241, 21547257, 22384011, 22664781, 24699314, 25424368, 34573427, 35795669, 40594750
Coronavirus Infections	Inhibit	24503068
Coronavirus Infections	Stimulate	24725946
Cough	Associate	28842514
COVID 19	Inhibit	24503068, 32866645
COVID 19	Associate	32501293, 33138195, 33726831, 33804769, 34020127, 34174375, 34910814, 34975885, 36420258
COVID 19	Stimulate	32592406, 32866033, 34543980, 37483627
Crohn Disease	Stimulate	16565224
Crohn Disease	Associate	28273887, 29556615
Cystic Fibrosis	Associate	12507912, 31118097
Cysts	Associate	31718213
Cytokine Release Syndrome	Associate	35040554
Cytomegalovirus Infections	Stimulate	18513272, 9261368
Death	Associate	17653092, 32411797
Death	Inhibit	24386086, 34910814
Death	Stimulate	28340601
Demyelinating Diseases	Associate	11091283
Dermatitis Atopic	Associate	15715189, 22272250, 31855303, 32280674, 39599592
Dermatitis Atopic 1	Associate	10792507
Dermatitis Atopic 1	Stimulate	8980953
Dermatitis Atopic 3	Associate	8980953
Developmental Defects of Enamel	Associate	37498839
Diabetes Complications	Associate	34573427
Diabetes Mellitus	Stimulate	18385799, 24936866
Diabetes Mellitus	Associate	24301906, 26268591, 29498364, 29513874, 30184318, 34573427, 40594750
Diabetes Mellitus Type 2	Associate	24936866, 34573427
Diabetic Nephropathies	Associate	17728497, 29207157, 36726458, 37656997, 37986381
Diabetic Retinopathy	Stimulate	26268591
DNA Repair Deficiency Disorders	Stimulate	31991061
Drug Hypersensitivity	Associate	10086850, 7539041, 7561163, 8977128
Dry Eye Syndromes	Associate	37876509
Embolism Air	Associate	24945146
Encephalitis	Associate	23639073
Encephalitis	Stimulate	24413261
Encephalitis Japanese	Associate	29057937
Encephalitis Tick Borne	Stimulate	26906062
Endocrine System Diseases	Associate	29498364
Endometriosis	Associate	17678915
Enterovirus Infections	Associate	26304916
Eosinophilia	Associate	26047816
Eosinophilic Esophagitis	Stimulate	21921589
Eosinophilic pustular folliculitis	Associate	11501668
Epstein Barr Virus Infections	Stimulate	10194423, 14747532, 29569795
Epstein Barr Virus Infections	Associate	10393857
Erdheim Chester Disease	Associate	17133532
Esophageal Neoplasms	Associate	15226608, 33323552
Esophageal Squamous Cell Carcinoma	Stimulate	26317795
Esophageal Squamous Cell Carcinoma	Associate	36514094, 36680938
Familial Primary Pulmonary Hypertension	Associate	33478117
Fatigue	Associate	23566546
Fibrosis	Associate	17428349, 27569940, 28318046, 31200663, 40596471
Fragile X Syndrome	Associate	20102735
Gastritis	Associate	14704722
GATA2 Deficiency	Associate	11079620
Geographic Atrophy	Stimulate	32324857
Gingivitis	Associate	11472436
Glioblastoma	Associate	32545571, 40076291
Glioma	Associate	21900396, 31593589
Glioma	Stimulate	26749234, 31649684
Glomerulonephritis	Associate	16436653, 17428349
Glomerulonephritis IGA	Associate	16555943, 27044423
Glomerulonephritis Membranous	Associate	10620196, 30865617
Graft vs Host Disease	Associate	28687251
Granuloma	Associate	16565224, 25566510, 27668525, 7513016
Granuloma	Stimulate	31718213
Granulomatosis with Polyangiitis	Stimulate	15807865
Graves Disease	Stimulate	22506015
Graves Disease	Associate	27245471
Hand Foot Syndrome	Associate	29606345
Hashimoto Disease	Associate	36266640
Heart Failure	Associate	35346191, 36420258, 38065888, 39675594
Helicobacter Infections	Stimulate	9659152
Hematoma	Associate	28282868
Hemochromatosis	Associate	37175780
Hemolytic Uremic Syndrome	Associate	33574979
Hemophilia A	Stimulate	21422116
Hepatic Encephalopathy	Associate	34938356
Hepatitis B	Associate	31200663
Hepatitis B Chronic	Associate	31200663
Hepatitis C	Stimulate	15770052
Hepatitis C	Associate	16437690, 25022296, 27304910
Hepatitis C Chronic	Associate	15770052
Hereditary Myopathy with Early Respiratory Failure	Associate	9176534
Hereditary Sensory and Autonomic Neuropathies	Stimulate	22048272
Herpes Simplex	Associate	34552595
Hidradenitis Suppurativa	Associate	27206704
HIV Infections	Associate	10200305, 10477684, 11079620, 11320252, 12114533, 12426633, 16437690, 18391751, 20416280, 23240012, 23258923, 25313609, 25383745, 26137563, 27304910 View all (10 more)
HIV Infections	Stimulate	10540164, 11878903, 18403790, 20531015, 21945445
HIV Infections	Inhibit	10820198, 12791668, 15220435, 16232220, 26506568
Hodgkin Disease	Associate	10194423, 18070985
HTLV I Infections	Inhibit	15827177
HTLV I Infections	Associate	16015368, 25521499, 9420304
Hyperandrogenism	Stimulate	34119324
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	17728497
Hypersensitivity Delayed	Associate	7513016
Hypertension	Associate	33974269
Hypoxia	Inhibit	10427991, 30459756
Hypoxia	Stimulate	22380870, 27129235
Hypoxia	Associate	30778913, 33737938
IgA Deficiency	Stimulate	27044423
IgA Vasculitis	Associate	12588667, 25839768, 7680648
Ige Responsiveness Atopic	Associate	16024972
Immune Reconstitution Inflammatory Syndrome	Associate	22048272
Infections	Stimulate	10347159, 11922866, 26732368, 29463209, 32501293, 32745093, 36482106, 9573240
Infections	Associate	10477684, 16232220, 25404022, 25573478, 35418661, 37881339
Infections	Inhibit	11118364, 11134270, 11739668, 11836402, 9875320
Infectious Mononucleosis	Associate	10393857
Inflammation	Associate	10488085, 11028855, 11090473, 11348464, 11472436, 11501668, 11507211, 11821046, 12122011, 12176812, 12204866, 12388374, 12819056, 12909630, 14704722 View all (89 more)
Inflammation	Stimulate	24895488, 24986468, 31559531, 32835907, 34220803, 35269407, 39488256
Inflammatory Bowel Diseases	Stimulate	16565224
Inflammatory Bowel Diseases	Associate	36726458
Influenza Human	Associate	30954271
Influenza Human	Inhibit	34490131
Influenza Human	Stimulate	9064338
Insulin Resistance	Associate	24895488, 34573427
Insulin Resistance	Stimulate	34119324
Intervertebral disc disease	Associate	36293070
Intestinal Diseases	Inhibit	14704722
Intracranial Aneurysm	Associate	23887838
Intracranial Hypertension	Associate	17417600
Invasive Pulmonary Aspergillosis	Stimulate	22731696
Job Syndrome	Associate	39229272
Keratitis Ichthyosis Deafness Syndrome	Inhibit	30150638
Keratoconus	Associate	37460969
Kidney Diseases	Associate	21533139, 34573427
Lead Poisoning Nervous System	Associate	35788177
Leprosy Tuberculoid	Stimulate	14632750
Leukemia Lymphocytic Chronic B Cell	Stimulate	16113842
Leukemia Lymphocytic Chronic B Cell	Associate	20038229
Leukemia Mast Cell	Associate	8188667
Leukemia Myeloid Acute	Associate	26081440, 31955503, 39191856, 39506790
Leukemia Myeloid Acute	Stimulate	30396908
Leukocytosis	Stimulate	26906062
Lichen Planus	Associate	9856808
Lichen Planus Oral	Associate	12819030
Liver Cirrhosis	Associate	28467457
Liver Cirrhosis	Inhibit	31200663
Liver Cirrhosis Biliary	Stimulate	40596471
Liver Failure	Stimulate	31200663
Liver Failure	Associate	35726350
Liver Neoplasms	Associate	36332449
Lung Diseases	Associate	12388374, 14514472, 9192918
Lung Diseases	Stimulate	36255321
Lung Injury	Associate	35487970
Lung Neoplasms	Associate	17653092, 25305322, 31855281, 32549766, 35910766
Lupus Erythematosus Discoid	Associate	26568320
Lupus Erythematosus Systemic	Associate	20589685, 28954264
Lupus Erythematosus Systemic	Stimulate	23298254, 27852285
Lymphatic Metastasis	Associate	19846984, 22380870
Lymphatic Metastasis	Stimulate	31578575
Lymphoma Follicular	Associate	20038229
Lymphoma Large B Cell Diffuse	Associate	34516642
Lymphoma T Cell	Associate	37325644
Lymphoproliferative Disorders	Inhibit	10393857
Malaria	Inhibit	15972509
Malformations of Cortical Development	Associate	23639073
Mannose Binding Protein Deficiency	Inhibit	26745156
Measles	Stimulate	10074163
Measles	Associate	12808325
Melanoma	Stimulate	11369232
Melanoma	Associate	25944800, 29368981, 37730606
Melanoma Cutaneous Malignant	Associate	36443341
Meningioma	Associate	12117909
Mesothelioma Malignant	Associate	25162674
Mouth Diseases	Associate	24453419, 25928531
Mouth Neoplasms	Associate	20622890, 25271422
Moyamoya Disease	Associate	28072843
Mucocutaneous Lymph Node Syndrome	Associate	33188570
Multiple Myeloma	Associate	27983725
Multiple Sclerosis	Associate	10079101, 11389171, 11696431, 11966770, 12909630, 31191554, 9584001, 9916917
Muscular Atrophy Spinal	Associate	37830588
Myasthenic Syndromes Congenital	Associate	16272363
Myocardial Infarction	Associate	21547257, 29381915
Myocardial Infarction	Stimulate	22664781
Myositis	Associate	40114239
Myotonic Dystrophy	Inhibit	26211001
Myotonic Dystrophy	Associate	33530452
Nasal Polyps	Associate	22344830, 28842563, 36211987, 8876553
Nasal Polyps	Stimulate	32085629
Nasopharyngeal Carcinoma	Associate	22226739, 29569795
Neoplasm Metastasis	Associate	21486440, 22506069, 26173622, 27027351, 29288523, 29358632, 30224826, 31578575, 33245226, 35845981, 36438499
Neoplasm Metastasis	Inhibit	36090993
Neoplasms	Associate	11258708, 18697197, 19242540, 19293190, 21921047, 21930732, 22226739, 22380870, 22506069, 22593190, 23566546, 23957698, 24129241, 24204919, 25271422 View all (41 more)
Neoplasms	Stimulate	15123743, 26749234, 29368981, 29872080, 32081834, 35618288
Neoplasms	Inhibit	34218795
Neoplasms Adipose Tissue	Associate	31718015
Neoplasms Squamous Cell	Stimulate	31811114
Neoplasms Unknown Primary	Stimulate	23696928
Neurodegenerative Diseases	Associate	11161609
Neuroinflammatory Diseases	Associate	37735116
Neurologic Manifestations	Associate	36691005
Neurotoxicity Syndromes	Inhibit	10820198
Neutrophil Immunodeficiency Syndrome	Associate	16029496
Nocturnal Myoclonus Syndrome	Associate	37563071
Non alcoholic Fatty Liver Disease	Stimulate	39583964
Obesity	Associate	17578888, 22228716, 23894433, 24895488, 34573427
Obesity	Inhibit	23857381
Optic Nerve Hypoplasia	Associate	37498839
Osteoarthritis	Stimulate	10337033
Osteoarthritis	Associate	11352237, 20862675
Osteoarthritis Knee	Associate	21336628
Osteogenesis imperfecta type 6	Associate	16524739
Osteoporosis	Associate	36755691
Osteosarcoma	Associate	22506069, 40374042
Otitis Media	Associate	19728873
Ovarian Neoplasms	Associate	25712684, 29170526, 31991061, 33721368, 35012533, 36766725, 37264954
Ovarian Neoplasms	Stimulate	28868628
Pain	Associate	35845981
Pancreatic Neoplasms	Stimulate	19874825
Pancreatic Neoplasms	Associate	29358632
Paramyxoviridae Infections	Stimulate	20182399
Parkinson Disease Secondary	Stimulate	31559531
Pemphigus and fogo selvagem	Stimulate	35632621
Peri Implantitis	Associate	11395370
Periapical Diseases	Associate	31718213
Periodic fever familial autosomal dominant	Associate	19116900
Periodontitis	Associate	11472436, 37510279
Peripheral Arterial Disease	Associate	32835907
Peritonitis	Associate	19846984
Peritonitis	Inhibit	34360900
Persistent Infection	Stimulate	32408187
Phyllodes Tumor	Associate	37240386
Plaque Atherosclerotic	Associate	25383745
Plasma Cell Granuloma Pulmonary	Associate	12388374
Pneumonia	Associate	24067464, 28381820
Pneumonia Pneumococcal	Associate	24067464
Polycystic Ovary Syndrome	Stimulate	34119324
Polyps	Stimulate	22936091
Polyps	Associate	8876553
Post Acute COVID 19 Syndrome	Stimulate	38326527
Prader Willi Syndrome	Stimulate	25691409
Pre Eclampsia	Stimulate	15954879
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19388934
Prostatic Hyperplasia	Associate	28216616
Prostatic Neoplasms	Associate	19099590, 19242540, 29288523, 38087324
Prostatic Neoplasms Castration Resistant	Associate	38057852
Prostatitis	Associate	19242540
Proteinuria	Associate	16555943
Psoriasis	Associate	10086850, 34122426
Pulmonary Arterial Hypertension	Associate	33816621
Pulmonary Atelectasis	Associate	34089082
Pulmonary Atelectasis	Stimulate	35487970
Pulmonary Disease Chronic Obstructive	Associate	16029496, 18727632, 19153534, 23267209, 23384071, 26965295, 29535517, 34588774
Pulmonary Disease Chronic Obstructive	Stimulate	19229703, 27199554
Pulmonary Embolism	Stimulate	33810533
Pulmonary Fibrosis	Associate	12449175
Pulmonary Fibrosis	Stimulate	19729668
Purpura Thrombocytopenic Idiopathic	Associate	27776524
Pyoderma Gangrenosum	Stimulate	24903614, 25501066
Q Fever	Associate	31001808
Radicular Cyst	Stimulate	31718213
Renal Insufficiency	Associate	29498364
Renal Insufficiency Chronic	Associate	27569940
Renal Insufficiency Chronic	Inhibit	30280599
Renal Insufficiency Chronic	Stimulate	32046176
Respiratory Distress Syndrome	Associate	32321279
Respiratory Distress Syndrome	Inhibit	37290572
Respiratory Syncytial Virus Infections	Stimulate	17460443, 19369476
Respiratory Tract Diseases	Associate	23181789, 26304916
Restless Legs Syndrome	Associate	37563071
Rhinitis	Associate	8977128
Rhinitis Allergic	Associate	17982926, 19153534, 20459697, 27667736
Rupture	Associate	22664781
Sarcoidosis	Stimulate	12449175, 9192918
Sarcoidosis	Associate	25004830
Sarcoidosis Pulmonary	Associate	12449175
Schizophrenia	Stimulate	37075652
Scleroderma Diffuse	Stimulate	18432520
Sepsis	Associate	35184762
Severe Acute Respiratory Syndrome	Associate	17540042
Severe Acute Respiratory Syndrome	Stimulate	21422116
Severe combined immunodeficiency due to adenosine deaminase deficiency	Associate	9420304
Sjogren's Syndrome	Associate	29504848, 34386009, 35720379
Sjogren's Syndrome	Stimulate	31086200
Skin Diseases	Stimulate	12603855
Skin Diseases	Associate	1380064, 28954264
Skin Manifestations	Associate	25839768
Skin Neoplasms	Associate	34768877
Sleep Apnea Obstructive	Associate	20847078
Small Cell Lung Carcinoma	Inhibit	39516747
Spinal Cord Injuries	Associate	35412793
Spondylarthritis	Associate	18311795
Squamous Cell Carcinoma of Head and Neck	Associate	20622890, 25271422, 34697152
Squamous Cell Carcinoma of Head and Neck	Stimulate	20702412
Status Asthmaticus	Associate	17302903, 24295867, 25897650, 28168862
Status Asthmaticus	Inhibit	23857381
Stomach Diseases	Associate	32630408
Stomach Neoplasms	Associate	19846984, 21284875, 24323564, 24396281, 35261108
Stroke	Associate	17183455
Subarachnoid Hemorrhage	Associate	36214715, 38173028
Sweet Syndrome	Associate	24903614
Synovitis	Associate	25724256
Takayasu Arteritis	Associate	35126357, 35172901
Tarlov Cysts	Associate	29549020
Tertiary Lymphoid Structures	Associate	27027351
Thrombocythemia Essential	Associate	32425934
Thrombosis	Associate	22955940
Thymic epithelial tumor	Associate	16272363
Thyroid Cancer Papillary	Associate	23957698, 35515000, 36266640
Thyroid Diseases	Associate	29498364
Thyroiditis Autoimmune	Associate	27245471, 32604892
Transient erythroblastopenia of childhood	Stimulate	23717673
Triple Negative Breast Neoplasms	Associate	26752006, 27027351, 29559701, 31105691, 35377948, 37342906
Triple Negative Breast Neoplasms	Stimulate	35268073
Tuberculosis	Associate	15117956, 27668525, 33679683
Tuberculosis Lymph Node	Associate	36439164
Tuberculosis Meningeal	Associate	29664036
Tuberculosis Meningeal	Inhibit	35710869
Tuberculosis Pleural	Stimulate	24584041
Tuberculosis Pulmonary	Associate	15117956, 27668525, 29664036
Tuberous Sclerosis	Associate	36111504
Urethral Stricture	Associate	38593413
Urinary Bladder Neoplasms	Stimulate	11904733, 39231199
Urinary Bladder Neoplasms	Associate	30310111, 34893045
Urticaria	Associate	36539847
Uterine Cervical Dysplasia	Associate	31121496
Uterine Cervical Neoplasms	Associate	39901166
Uveal melanoma	Associate	32957329
Uveitis Posterior	Associate	17417600
Vaginosis Bacterial	Stimulate	22027006
Varicose Ulcer	Associate	40149931
Varicose Veins	Associate	19729323
Varicose Veins	Stimulate	24741602
Venous Insufficiency	Associate	24741602
Viremia	Associate	29768624
Virus Diseases	Associate	12388374, 20523058, 27667736
Waldenstrom Macroglobulinemia	Stimulate	21921047
Wounds and Injuries	Associate	40149931
Zika Virus Infection	Associate	32745093

CCL5 (C-C motif chemokine ligand 5)