SCTR (secretin receptor)

Gene

• Entrez ID: 6344
• Gene name: Secretin receptor
• Gene symbol: SCTR
• Synonyms (NCBI Gene): SECR, SR
• Chromosome: 2
• Chromosome location: 2q14.2
• Summary: The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its r

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	14645499
SP3	Unknown	14645499

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002024	Process	Diet induced thermogenesis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	7612008
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	32811827
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0009992	Process	Intracellular water homeostasis	ISS
GO:0015055	Function	Secretin receptor activity	IBA
GO:0015055	Function	Secretin receptor activity	IDA	7612008, 32811827, 33008599
GO:0015055	Function	Secretin receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0017046	Function	Peptide hormone binding	IPI	7612008
GO:0031667	Process	Response to nutrient levels	ISS
GO:0032098	Process	Regulation of appetite	ISS
GO:0048167	Process	Regulation of synaptic plasticity	ISS

Other IDs

• MIM: 182098
• HGNC: 10608
• e!Ensembl: ENSG00000080293

Protein

• UniProt ID: P47872
• Protein name: Secretin receptor (SCT-R) (SECR)
• Protein function: G protein-coupled receptor activated by secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973, PubMed:32811827, PubMed:33008599, PubMed:7
• PDB: 6WI9, 6WZG, 7D3S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02793	HRM	63 → 126	Hormone receptor domain	Family
  PF00002	7tm_2	139 → 384	7 transmembrane receptor (Secretin family)	Family

• Sequence:

  MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTE
  QPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPN
  LACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMH
  LFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYL
  HTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
  PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAF
  SPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS
  NSTKASHLEQSQGTCRTSII

• Sequence length: 440

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Pancreatic secretion
Bile secretion

Reactome:

G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Biliary Atresia	Associate	35508528	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Associate	18223557	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	18223557	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Inhibit	34543480	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	18223557	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Associate	35508528	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	18403637, 32970347	★☆☆☆☆ Found in Text Mining only
Constriction Pathologic	Inhibit	34543480	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	35508528	★☆☆☆☆ Found in Text Mining only
Gastrinoma	Associate	17711922	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	18223557	★☆☆☆☆ Found in Text Mining only
Jaundice	Associate	35508528	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Associate	35508528	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	35508528	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	24114056	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	25241033	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	18223557, 21625944	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors Primitive	Inhibit	24114056	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	23158174	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	16819820	★☆☆☆☆ Found in Text Mining only