Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6344
Gene name Gene Name - the full gene name approved by the HGNC.	Secretin receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SCTR
Synonyms (NCBI Gene) Gene synonyms aliases	SECR, SR
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its r

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SP1	Unknown	14645499
SP3	Unknown	14645499

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002024	Process	Diet induced thermogenesis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	7612008
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	32811827
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0009992	Process	Intracellular water homeostasis	ISS
GO:0015055	Function	Secretin receptor activity	IBA
GO:0015055	Function	Secretin receptor activity	IDA	7612008, 32811827, 33008599
GO:0015055	Function	Secretin receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0017046	Function	Peptide hormone binding	IPI	7612008
GO:0031667	Process	Response to nutrient levels	ISS
GO:0032098	Process	Regulation of appetite	ISS
GO:0048167	Process	Regulation of synaptic plasticity	ISS

MIM	HGNC	e!Ensembl
182098	10608	ENSG00000080293

Protein

UniProt ID

P47872

Protein name

Secretin receptor (SCT-R) (SECR)

Protein function

G protein-coupled receptor activated by secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973, PubMed:32811827, PubMed:33008599, PubMed:7

PDB

6WI9 , 6WZG , 7D3S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	63 → 126	Hormone receptor domain	Family
PF00002	7tm_2	139 → 384	7 transmembrane receptor (Secretin family)	Family

Sequence

MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTE
QPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPN
LACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMH
LFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYL
HTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAF
SPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS
NSTKASHLEQSQGTCRTSII

Sequence length

440

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Pancreatic secretion Bile secretion		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Biliary Atresia	Associate	35508528
Carcinoid Tumor	Associate	18223557
Carcinoma Non Small Cell Lung	Associate	18223557
Carotid Artery Thrombosis	Inhibit	34543480
Cholangiocarcinoma	Associate	18223557
Cholestasis	Associate	35508528
Colorectal Neoplasms	Associate	18403637, 32970347
Constriction Pathologic	Inhibit	34543480
Fibrosis	Associate	35508528
Gastrinoma	Associate	17711922
Inflammation	Associate	18223557
Jaundice	Associate	35508528
Liver Cirrhosis	Associate	35508528
Liver Failure	Associate	35508528
Neoplasm Metastasis	Inhibit	24114056
Neoplasm Metastasis	Associate	25241033
Neoplasms	Associate	18223557, 21625944
Neuroectodermal Tumors Primitive	Inhibit	24114056
Neuroendocrine Tumors	Associate	23158174
Pancreatic Neoplasms	Associate	16819820

SCTR (secretin receptor)