CLEC11A (C-type lectin domain containing 11A)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6320
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain containing 11A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC11A
Synonyms (NCBI Gene) Gene synonyms aliases
CLECSF3, LSLCL, P47, SCGF
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its bi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT017922 hsa-miR-335-5p Microarray 18185580
MIRT023286 hsa-miR-122-5p Microarray 17612493
MIRT1965544 hsa-miR-1233 CLIP-seq
MIRT1965545 hsa-miR-335 CLIP-seq
MIRT1965546 hsa-miR-4290 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0001503 Process Ossification IBA 21873635
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005576 Component Extracellular region IDA 9442024
GO:0005615 Component Extracellular space HDA 16502470
GO:0005615 Component Extracellular space IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
604713 10576 ENSG00000105472
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9Y240
Protein name C-type lectin domain family 11 member A (C-type lectin superfamily member 3) (Lymphocyte secreted C-type lectin) (Osteolectin) (Stem cell growth factor) (p47)
Protein function Promotes osteogenesis by stimulating the differentiation of mesenchymal progenitors into mature osteoblasts (PubMed:27976999). Important for repair and maintenance of adult bone (By similarity). {ECO:0000250|UniProtKB:O88200, ECO:0000269|PubMed:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 195 → 321 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. {E
Sequence 
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAG
RGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDA
GLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKG
LRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWL
GVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQA
SDDGSWWDHDCQRRLYYVCEFPF
Sequence length 323
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)		 19884328
Osteoporosis Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis rs72658152, rs72667023, rs587776916, rs72656370, rs768615287 27976999
Show/Hide Text Mining Associations (18)
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 37012247
Carcinoma Hepatocellular Associate 30168613
Carcinoma Pancreatic Ductal Associate 33593879
Diabetes Mellitus Associate 37078556
Inflammation Associate 21943129
Keratoderma Palmoplantar Associate 30168613
Leukemia Myeloid Acute Associate 29956722, 37798266
Neoplasms Stimulate 21943129
Neoplasms Associate 36305631, 37597212
Neuromyelitis Optica Associate 40294019