CLEC11A (C-type lectin domain containing 11A)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 6320
Gene name C-type lectin domain containing 11A
Gene symbol CLEC11A
Synonyms (NCBI Gene)
CLECSF3LSLCLP47SCGF
Chromosome 19
Chromosome location 19q13.33
Summary This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its bi
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT017922 hsa-miR-335-5p Microarray 18185580
MIRT023286 hsa-miR-122-5p Microarray 17612493
MIRT1965544 hsa-miR-1233 CLIP-seq
MIRT1965545 hsa-miR-335 CLIP-seq
MIRT1965546 hsa-miR-4290 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0001503 Process Ossification IBA
GO:0001503 Process Ossification IEA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005576 Component Extracellular region IDA 9442024
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
604713 10576 ENSG00000105472
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y240
Protein name C-type lectin domain family 11 member A (C-type lectin superfamily member 3) (Lymphocyte secreted C-type lectin) (Osteolectin) (Stem cell growth factor) (p47)
Protein function Promotes osteogenesis by stimulating the differentiation of mesenchymal progenitors into mature osteoblasts (PubMed:27976999). Important for repair and maintenance of adult bone (By similarity). {ECO:0000250|UniProtKB:O88200, ECO:0000269|PubMed:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 195 → 321 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. {E
Sequence 
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAG
RGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDA
GLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKG
LRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWL
GVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQA
SDDGSWWDHDCQRRLYYVCEFPF
Sequence length 323
Interactions View interactions