Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6317
Gene name Gene Name - the full gene name approved by the HGNC.	Serpin family B member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SERPINB3
Synonyms (NCBI Gene) Gene synonyms aliases	HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q21.33

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT443662	hsa-miR-4517	PAR-CLIP	22100165
MIRT443661	hsa-miR-3123	PAR-CLIP	22100165
MIRT443660	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443659	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443662	hsa-miR-4517	PAR-CLIP	22100165
MIRT443661	hsa-miR-3123	PAR-CLIP	22100165
MIRT443660	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443659	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT2100126	hsa-miR-4719	CLIP-seq
MIRT2325019	hsa-miR-4282	CLIP-seq
MIRT2100126	hsa-miR-4719	CLIP-seq
MIRT2620599	hsa-miR-3671	CLIP-seq
MIRT2620600	hsa-miR-607	CLIP-seq
MIRT2620599	hsa-miR-3671	CLIP-seq
MIRT2620600	hsa-miR-607	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	12975381
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	21383048
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	NAS	7724531
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IMP	21383048
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	20527027, 21383048
GO:0005737	Component	Cytoplasm	IDA	20527027
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20527027
GO:0010466	Process	Negative regulation of peptidase activity	IDA	12949073
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	20527027
GO:0010950	Process	Positive regulation of endopeptidase activity	IDA	20527027
GO:0010951	Process	Negative regulation of endopeptidase activity	IMP	21383048
GO:0030335	Process	Positive regulation of cell migration	IMP	20527027
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	21383048
GO:0031982	Component	Vesicle	HDA	19190083
GO:0035425	Process	Autocrine signaling	IMP	20527027
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0038001	Process	Paracrine signaling	IMP	20527027
GO:0043086	Process	Negative regulation of catalytic activity	IDA	10956412
GO:0043508	Process	Negative regulation of JUN kinase activity	IMP	21383048
GO:0045861	Process	Negative regulation of proteolysis	IDA	12975381
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070062	Component	Extracellular exosome	IDA	21557262

MIM	HGNC	e!Ensembl
600517	10569	ENSG00000057149

Protein

UniProt ID

P29508

Protein name

Serpin B3 (Protein T4-A) (Squamous cell carcinoma antigen 1) (SCCA-1)

Protein function

May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1). {ECO:000

PDB

2ZV6 , 4ZK0 , 4ZK3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	6 → 390	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Squamous cells. Expressed in some hepatocellular carcinoma (at protein level). {ECO:0000269|PubMed:14970861}.

Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFD
QVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL
DAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAI
YFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR
TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN
EEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	Amoebiasis		Neutrophil degranulation

SERPINB3 (serpin family B member 3)