S100P (S100 calcium binding protein P)

Gene

• Entrez ID: 6286
• Gene name: S100 calcium binding protein P
• Gene symbol: S100P
• Synonyms (NCBI Gene): MIG9
• Chromosome: 4
• Chromosome location: 4p16.1
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029220	hsa-miR-26b-5p	Microarray	19088304
MIRT030424	hsa-miR-24-3p	Microarray	19748357
MIRT736285	hsa-miR-495-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33949774
MIRT1324171	hsa-miR-24	CLIP-seq
MIRT1324172	hsa-miR-3135	CLIP-seq
MIRT1324173	hsa-miR-3155	CLIP-seq
MIRT1324174	hsa-miR-3155b	CLIP-seq
MIRT1324175	hsa-miR-4257	CLIP-seq
MIRT1324176	hsa-miR-4468	CLIP-seq
MIRT1324177	hsa-miR-4690-5p	CLIP-seq
MIRT1324178	hsa-miR-484	CLIP-seq
MIRT1324172	hsa-miR-3135	CLIP-seq
MIRT2320454	hsa-miR-302f	CLIP-seq
MIRT2320455	hsa-miR-591	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Unknown	19073601
NR3C1	Unknown	21751241

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	TAS	15632002
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	1633809
GO:0005515	Function	Protein binding	IPI	11747429, 12042313, 15171681, 16061848, 16189514, 21044950, 25416956, 25554515, 26496610, 26551460, 27107012, 31837246, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	15632002
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	15632002
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0031528	Component	Microvillus membrane	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	11747429
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IBA
GO:0043542	Process	Endothelial cell migration	IMP	15313892
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0048306	Function	Calcium-dependent protein binding	IPI	15632002
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 600614
• HGNC: 10504
• e!Ensembl: ENSG00000163993

Protein

• UniProt ID: P25815
• Protein name: Protein S100-P (Migration-inducing gene 9 protein) (MIG9) (Protein S100-E) (S100 calcium-binding protein P)
• Protein function: May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the form
• PDB: 1J55, 1OZO, 2MJW, 7NMI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	4 → 46	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreat
• Sequence:

  MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
  LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

• Sequence length: 95

Pathways

Reactome:

Neutrophil degranulation