S100P (S100 calcium binding protein P)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6286
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein P
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100P
Synonyms (NCBI Gene) Gene synonyms aliases
MIG9
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(14)
miRTarBase ID miRNA Experiments Reference
MIRT029220 hsa-miR-26b-5p Microarray 19088304
MIRT030424 hsa-miR-24-3p Microarray 19748357
MIRT736285 hsa-miR-495-3p Luciferase reporter assay, Western blotting, qRT-PCR 33949774
MIRT1324171 hsa-miR-24 CLIP-seq
MIRT1324172 hsa-miR-3135 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(2)
Transcription factor Regulation Reference
ATF4 Unknown 19073601
NR3C1 Unknown 21751241
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(28)
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding TAS 15632002
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding TAS 1633809
GO:0005515 Function Protein binding IPI 11747429, 12042313, 15171681, 16061848, 16189514, 21044950, 25416956, 25554515, 26496610, 26551460, 27107012, 31837246, 32296183, 32814053, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
600614 10504 ENSG00000163993
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID P25815
Protein name Protein S100-P (Migration-inducing gene 9 protein) (MIG9) (Protein S100-E) (S100 calcium-binding protein P)
Protein function May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the form
PDB 1J55 , 1OZO , 2MJW , 7NMI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 4 → 46 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreat
Sequence 
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Sequence length 95
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  Reactome
    Neutrophil degranulation
<